KEGG   Homo sapiens (human): 11136
Entry
11136             CDS       T01001                                 

Gene name
SLC7A9, BAT1, CSNU3
Definition
(RefSeq) solute carrier family 7 member 9
  KO
K13868  solute carrier family 7 (L-type amino acid transporter), member 9/15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00901  Cystinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    11136 (SLC7A9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    11136 (SLC7A9)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   11136 (SLC7A9)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 11136
NCBI-ProteinID: NP_001119807
OMIM: 604144
HGNC: 11067
Ensembl: ENSG00000021488
Vega: OTTHUMG00000180287
Pharos: P82251(Tbio)
UniProt: P82251
Position
19q13.11
AA seq 487 aa
MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTE
AVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYLMEAYGPIPAYLFSWASLIVI
KPTSFAIICLSFSEYVCAPFYVGCKPPQIVVKCLAAAAILFISTVNSLSVRLGSYVQNIF
TAAKLVIVAIIIISGLVLLAQGNTKNFDNSFEGAQLSVGAISLAFYNGLWAYDGWNQLNY
ITEELRNPYRNLPLAIIIGIPLVTACYILMNVSYFTVMTATELLQSQAVAVTFGDRVLYP
ASWIVPLFVAFSTIGAANGTCFTAGRLIYVAGREGHMLKVLSYISVRRLTPAPAIIFYGI
IATIYIIPGDINSLVNYFSFAAWLFYGLTILGLIVMRFTRKELERPIKVPVVIPVLMTLI
SVFLVLAPIISKPTWEYLYCVLFILSGLLFYFLFVHYKFGWAQKISKPITMHLQMLMEVV
PPEEDPE
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgggggatactggcctgagaaagcggagagaggatgagaagtcgatccagagccaagag
cctaagaccaccagtctccaaaaggagctgggcctcatcagtggcatctccatcatcgtg
ggcaccatcattggctctgggatcttcgtttcccccaagtctgtgctcagcaacacggaa
gctgtggggccctgcctcatcatatgggcggcttgcggggtcctcgcgacgctgggtgcc
ctgtgctttgcggagcttggcacaatgatcaccaagtcagggggagagtatccctacctg
atggaggcctacgggcccatccccgcctacctcttctcctgggccagcctgatcgtcatt
aagcccacgtccttcgccatcatctgcctcagcttctccgagtatgtgtgtgcgcccttc
tatgtgggctgcaagcctcctcaaatcgttgtgaaatgcctggccgccgccgccatcttg
ttcatctcgacagtgaactcactgagcgtgcggctgggaagctacgtccagaacatcttc
accgcggccaagctggtgatcgtggccatcatcatcatcagcgggctggtgctcctggcc
caaggaaacacaaagaattttgataattctttcgagggcgcccagctgtctgtgggagcc
atcagcctggcgttttacaatggactctgggcctatgatggatggaatcaactcaattac
atcacagaagaacttagaaacccttacagaaacctgcctttggccattatcatcgggatc
cccctggtgacggcgtgctacatcctcatgaacgtgtcctacttcaccgtgatgactgcc
accgaactcctgcagtcccaggcggtggctgtgacatttggtgaccgtgttctctatcct
gcttcttggatcgttccactttttgtggcattttcaaccatcggtgctgctaacgggacc
tgcttcacagcgggcagactcatttacgtggcgggccgggagggtcacatgctcaaagtg
ctttcttacatcagcgtcaggcgcctcactccagcccccgccatcatcttttatggtatc
atagcaacgatttatatcatccctggtgacataaactcgttagtcaattatttcagcttt
gccgcatggctgttttatggcctgacgattctaggactcatcgtgatgagatttacaagg
aaagagctggaaaggcctatcaaggtgcccgtagtcattcccgtcttgatgacactcatc
tctgtgtttttggttctggctccaatcatcagcaagcccacctgggagtacctctactgt
gtgctgtttatattaagcggccttttattttacttcctgtttgtccactacaagtttgga
tgggctcagaaaatctcaaagccgattaccatgcaccttcagatgctaatggaagtggtc
ccaccggaggaagaccctgagtaa

DBGET integrated database retrieval system