KEGG   Homo sapiens (human): 1114Help
Entry
1114              CDS       T01001                                 

Gene name
CHGB, SCG1
Definition
(RefSeq) chromogranin B
  KO
K19991  chromogranin-B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1114 (CHGB)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Others
   Others
    1114 (CHGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Granin
Motif
Other DBs
NCBI-GeneID: 1114
NCBI-ProteinID: NP_001810
OMIM: 118920
HGNC: 1930
Ensembl: ENSG00000089199
Vega: OTTHUMG00000031821
Pharos: P05060(Tbio)
UniProt: P05060
Position
20p12.3
AA seq 677 aa AA seqDB search
MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQV
LKTSRKDVKDKETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADT
EKWAEGGGHSRERADEPQWSLYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGE
DSSEEKHLEEPGETQNAFLNERKQASAIKKEELVARSETHAAGHSQEKTHSREKSSQESG
EETGSQENHPQESKGQPRSQEESEEGEEDATSEVDKRRTRPRHHHGRSRPDRSSQGGSLP
SEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWE
RYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHR
GRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAP
GKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRD
NMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQ
YDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLA
AMDLELQKIAEKFSQRG
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaacgctgcttctcagcctcctgggagccgtggggctggcggctgtcaattcc
atgccagtggataacaggaaccacaatgaaggaatggtgactcgctgcatcattgaggtc
ctctcaaatgccttgtcgaagtccagcgctccacccatcacccctgagtgccgccaagtc
ctgaagacgagtagaaaagacgtcaaagacaaagagacaactgaaaatgaaaacacaaag
tttgaagtaagattgttaagagacccagctgatgcctcggaagcccacgagtcctccagc
aggggagaggcaggagccccaggggaggaggacatccaaggcccaacaaaggcagacaca
gagaaatgggcagagggaggcgggcacagccgagagcgagcggatgagccccagtggagc
ctctatccctccgacagccaagtctctgaagaagtgaagacacgccattctgagaagagc
cagagagaggatgaggaggaggaggagggagagaactatcaaaaaggggagcgaggggaa
gatagcagtgaagagaaacaccttgaagagccaggagagacacaaaacgcttttctcaat
gaaagaaagcaggcttcagctataaaaaaagaggagttagtggccagatcggaaacacat
gctgccgggcattctcaggagaagacacatagccgagagaagagtagccaggagagtgga
gaggagacagggagccaggagaatcacccccaggagtctaaaggccaaccccgaagccag
gaagaatctgaggaaggtgaggaagatgccacctctgaggtggacaaacgacgcacgagg
cccagacaccaccacgggaggagcaggcccgacaggtcctctcaaggagggagtcttccc
tctgaggaaaagggacacccccaggaggaatctgaggagtcaaacgtcagcatggccagt
ttaggggaaaagagggaccaccattcaacccactacagggcttcagaggaagaacctgaa
tatggagaagaaataaagggttatccaggcgtccaggcccctgaggacctggagtgggag
cgctataggggcagaggaagtgaagaatacagggctccaagacctcagagtgaggagagt
tgggatgaggaggacaagagaaactaccccagcttagagcttgataagatggcacatgga
tatggtgaagaaagtgaggaagagaggggccttgagccgggaaagggacgccatcacaga
ggcaggggaggggagccacgtgcctatttcatgtctgacaccagagaagagaaaaggttc
ttgggtgaaggacaccaccgtgtccaagaaaaccagatggacaaggcaaggaggcatcca
caaggtgcgtggaaagagctggacagaaattatctcaactacggtgaggaaggagcccca
gggaagtggcagcagcagggagacctgcaggacactaaagaaaacagggaggaagctagg
tttcaagataaacaatatagctcccatcacacagctgaaaagaggaagagattaggggaa
ctgttcaacccatactacgaccctctccagtggaagagcagccattttgaaagaagagac
aacatgaatgacaattttctcgagggtgaggaggaaaatgagctgaccttgaacgagaag
aatttcttcccagaatacaactatgactggtgggagaaaaagcccttctctgaggatgtg
aactgggggtatgagaagagaaacctcgccagggtccccaagctggacctgaaaaggcaa
tatgacagggtggcccaactggaccagctccttcactacaggaagaagtcagctgagttt
ccagacttctatgattctgaggagccggtgagcacccaccaggaggcagaaaatgaaaag
gacagggctgaccagacagtcctgacagaggacgagaaaaaagaactcgaaaacttggct
gcaatggatttggaactacagaagatagctgagaaattcagccaaaggggctga

DBGET integrated database retrieval system