KEGG   Homo sapiens (human): 11140Help
Entry
11140             CDS       T01001                                 

Gene name
CDC37, P50CDC37
Definition
(RefSeq) cell division cycle 37
  KO
K09554  cell division cycle protein 37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    11140 (CDC37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    11140 (CDC37)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    11140 (CDC37)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    11140 (CDC37)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Cdc37 / p50
   11140 (CDC37)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    11140 (CDC37)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Intracellular proteins
   11140 (CDC37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDC37_M CDC37_C CDC37_N T3SSipB Med4 SPG48 Atg14
Motif
Other DBs
NCBI-GeneID: 11140
NCBI-ProteinID: NP_008996
OMIM: 605065
HGNC: 1735
Ensembl: ENSG00000105401
Vega: OTTHUMG00000180578
Pharos: Q16543(Tbio)
UniProt: Q16543 A0A024R7B7
Structure
PDB: 

Position
19p13.2
AA seq 378 aa AA seqDB search
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLEAVPKTGDEKDVSV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggtggactacagcgtgtgggaccacattgaggtgtctgatgatgaagacgagacgcac
cccaacatcgacacggccagtctcttccgctggcggcatcaggcccgggtggaacgcatg
gagcagttccagaaggagaaggaggaactggacaggggctgccgcgagtgcaagcgcaag
gtggccgagtgccagaggaaactgaaggagctggaggtggccgagggcggcaaggcagag
ctggagcgcctgcaggccgaggcacagcagctgcgcaaggaggagcggagctgggagcag
aagctggaggagatgcgcaagaaggagaagagcatgccctggaacgtggacacgctcagc
aaagacggcttcagcaagagcatggtaaataccaagcccgagaagacggaggaggactca
gaggaggtgagggagcagaaacacaagaccttcgtggaaaaatacgagaaacagatcaag
cactttggcatgcttcgccgctgggatgacagccaaaagtacctgtcagacaacgtccac
ctggtgtgcgaggagacagccaattacctggtcatttggtgcattgacctagaggtggag
gagaaatgtgcactcatggagcaggtggcccaccagacaatcgtcatgcaatttatcctg
gagctggccaagagcctaaaggtggacccccgggcctgcttccggcagttcttcactaag
attaagacagccgatcgccagtacatggagggcttcaacgacgagctggaagccttcaag
gagcgtgtgcggggccgtgccaagctgcgcatcgagaaggccatgaaggagtacgaggag
gaggagcgcaagaagcggctcggccccggcggcctggaccccgtcgaggtctacgagtcc
ctccctgaggaactccagaagtgcttcgatgtgaaggacgtgcagatgctgcaggacgcc
atcagcaagatggaccccaccgacgcaaagtaccacatgcagcgctgcattgactctggc
ctctgggtccccaactctaaggccagcgaggccaaggagggagaggaggcaggtcctggg
gacccattactggaagctgttcccaagacgggcgatgagaaggatgtcagtgtgtga

DBGET integrated database retrieval system