KEGG   Homo sapiens (human): 11144Help
Entry
11144             CDS       T01001                                 

Gene name
DMC1, DMC1H, LIM15, dJ199H16.1
Definition
(RefSeq) DNA meiotic recombinase 1
  KO
K10872  meiotic recombination protein DMC1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    11144 (DMC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     11144 (DMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 RecA ATPase AAA_25 HHH_5 NRD1_2 DnaB_C
Motif
Other DBs
NCBI-GeneID: 11144
NCBI-ProteinID: NP_008999
OMIM: 602721
HGNC: 2927
Ensembl: ENSG00000100206
Vega: OTTHUMG00000151088
Pharos: Q14565(Tbio)
UniProt: Q14565
Structure
PDB: 

Position
22q13.1
AA seq 340 aa AA seqDB search
MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALC
NVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMA
ITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVD
HDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELA
ERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTR
ISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggatcaagttgtggcggaagaaccaggattccaagatgaagaggaatctttg
tttcaagatattgacctgttacagaaacatggaattaacgtggctgacattaagaaactg
aaatcagtaggaatctgtaccatcaaaggtatacagatgacaacaagaagagctctatgc
aatgtcaaaggactctcagaagccaaagtagacaagattaaagaggcagcgaacaaacta
attgaaccaggattcttgactgcatttgagtatagtgaaaagaggaaaatggttttccat
atcaccaccgggagccaggaatttgataagttactaggaggtggaattgaaagtatggca
attacagaagcttttggagaatttcgtactggaaaaacccagctttctcataccctctgt
gtgacagctcaacttccaggagctggtggctacccaggaggaaagattatcttcattgat
acagaaaatactttccgtccagatcgccttagggacattgctgatcgctttaatgtagac
catgatgcagtactggacaacgtactttatgcacgtgcatatactagtgaacatcagatg
gagctacttgattatgtagcagcaaagttccatgaagaagctggcatcttcaagctattg
attatcgattcaataatggcactttttcgagtggatttcagtggccgtggggagttggcc
gaacggcagcaaaaattggcccagatgttgtcacgactccaaaaaatctcagaagaatat
aacgtggctgtttttgtgaccaatcaaatgactgccgatccaggagcaactatgaccttt
caggcagatcccaaaaaacccattgggggacacattctggctcatgcttcaacaacaaga
ataagcttgcgaaagggaagaggagagctcagaattgccaagatttatgacagtcctgag
atgcctgaaaatgaagccaccttcgcaataactgctggaggaattggggatgccaaggag
tag

DBGET integrated database retrieval system