KEGG   Homo sapiens (human): 11152
Entry
11152             CDS       T01001                                 

Gene name
WDR45, JM5, NBIA4, NBIA5, WDRX1, WIPI-4, WIPI4
Definition
(RefSeq) WD repeat domain 45
  KO
K22991  WD repeat-containing protein 45
Organism
hsa  Homo sapiens (human)
Disease
H00833  Neurodegeneration with brain iron accumulation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11152 (WDR45)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    11152 (WDR45)
SSDB
Motif
Pfam: WD40 CNH CPSF_A
Other DBs
NCBI-GeneID: 11152
NCBI-ProteinID: NP_001025067
OMIM: 300526
HGNC: 28912
Ensembl: ENSG00000196998
Vega: OTTHUMG00000034500
Pharos: Q9Y484(Tbio)
UniProt: Q9Y484 A0A024QYX1
Position
Xp11.23
AA seq 360 aa
MTQQPLRGVTSLRFNQDQSCFCCAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRS
NLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLK
NRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPG
TSSAPFTINAHQSDIACVSLNQPGTVVASASQKGTLIRLFDTQSKEKLVELRRGTDPATL
YCINFSHDSSFLCASSDKGTVHIFALKDTRLNRRSALARVGKVGPMIGQYVDSQWSLASF
TVPAESACICAFGRNTSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFDVYLDICDDDDF
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgactcaacagccacttcgaggagtgaccagcctgcgtttcaaccaagaccaaagctgc
ttttgctgcgccatggagacaggtgtgcgcatctacaacgtggagcccttgatggagaag
gggcatctggaccacgagcaggtgggcagcatgggcttggtggagatgctgcaccgctcc
aaccttctggccttggtgggcggtggtagtagtcccaagttctcagagatctcagtgctg
atctgggacgatgcccgggagggcaaggactccaaggagaagctggtgctggagttcacc
ttcaccaagccagtgctttctgtgcgcatgcgccatgacaagatcgtgatcgtgctgaag
aaccgcatctatgtgtactccttccccgacaatccccgaaagctgtttgagtttgatacc
cgggacaaccccaaggggctctgtgacctctgccccagcctggagaagcaactgctagtg
ttcccgggacacaagtgtgggagtctgcaacttgtggacctggcgagcacaaagcctggc
acctcgtctgctccattcacgatcaatgcacatcagagtgacatagcctgtgtgtctcta
aaccagccaggcactgtagtggcctcagcctcccagaagggtacccttattcgcctcttt
gacacacaatccaaggagaaactggtggagctgcgccgaggcactgaccctgccaccctc
tactgcattaacttcagccacgactcctccttcctctgcgcttccagtgataagggtact
gtccatatctttgctctcaaggatacccgcctcaaccgccgctccgcgctggctcgcgtg
ggcaaggtggggcctatgattgggcagtacgtggactctcagtggagcctggcgagcttc
actgtgcctgctgagtcagcttgcatctgcgccttcggtcgcaatacttccaagaacgtc
aactctgtcattgccatctgcgtagatgggaccttccacaaatatgtcttcactcctgat
ggaaactgcaacagagaggctttcgacgtgtaccttgacatctgtgatgatgatgacttt
taa

DBGET integrated database retrieval system