KEGG   Homo sapiens (human): 11154Help
Entry
11154             CDS       T01001                                 

Gene name
AP4S1, AP47B, CLA20, CLAPS4, CPSQ6, SPG52
Definition
(RefSeq) adaptor related protein complex 4 subunit sigma 1
  KO
K12403  AP-4 complex subunit sigma-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11154 (AP4S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11154 (AP4S1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    11154 (AP4S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s HOCHOB
Motif
Other DBs
NCBI-GeneID: 11154
NCBI-ProteinID: NP_001121598
OMIM: 607243
HGNC: 575
Ensembl: ENSG00000100478
Vega: OTTHUMG00000140202
Pharos: Q9Y587(Tdark)
UniProt: Q9Y587
Position
14q12
AA seq 144 aa AA seqDB search
MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYR
QYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKMSES
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatttttcctcatggtgaataaacaagggcagactcgactttctaagtactat
gaacatgtggatattaataagcgtacacttctggaaacagaagtcataaagagctgtctc
tctcgatccaatgaacaatgctctttcattgaatataaggattttaagctgatatatcgg
cagtatgcagctctcttcattgtggttggagttaatgacactgagaacgagatggctatt
tatgaattcattcataactttgtggaagttttagatgagtatttcagccgagtgagtgaa
ttagatataatgtttaatttggataaagtacacatcattttggatgagatggtgttaaat
ggctgcattgtggaaactaacagggcaagaattcttgcccctctactaattcttgataag
atgtcagaaagctga

DBGET integrated database retrieval system