KEGG   Homo sapiens (human): 11160Help
Entry
11160             CDS       T01001                                 

Gene name
ERLIN2, C8orf2, Erlin-2, NET32, SPFH2, SPG18
Definition
(RefSeq) ER lipid raft associated 2
Organism
hsa  Homo sapiens (human)
Disease
H00266  Hereditary spastic paraplegia
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 RapA_C DUF4346 POR_N
Motif
Other DBs
NCBI-GeneID: 11160
NCBI-ProteinID: NP_009106
OMIM: 611605
HGNC: 1356
Ensembl: ENSG00000147475
Vega: OTTHUMG00000164005
Pharos: O94905(Tbio)
UniProt: O94905 A0A384ME54
Position
8p11.23
AA seq 339 aa AA seqDB search
MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEK
KISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKD
IPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgggagcagttgtggctgtggcttccagtttcttttgtgcatctctcttc
tcagctgtgcacaagatagaagagggacatattggggtatattacagaggcggtgccctg
ctgacttcgaccagcggccctggtttccatctcatgctccctttcatcacatcatataag
tctgtgcagaccacactccagacagatgaggtgaagaatgtaccttgtgggactagtggt
ggtgtgatgatctactttgacagaattgaagtggtgaacttcctggtcccgaacgcagtg
tatgatatagtgaagaactatactgctgactatgacaaggccctcatcttcaacaagatc
caccacgaactgaaccagttctgcagtgtgcacacgcttcaagaggtctacattgagctg
tttgatcagattgatgaaaatctcaaactggctttgcaacaggacctgacctccatggcc
cctgggctggtcattcaagctgtgcgggtaacaaagcccaacataccagaggcaatccgc
agaaactacgagttgatggaaagtgagaagacaaagcttctcattgccgcccagaaacag
aaggtggtggaaaaggaagcagagacagagcggaagaaggcgctcattgaggcagaaaaa
gtggcccaggtggctgagatcacctacgggcagaaggtgatggagaaggagactgagaag
aagatttcagaaattgaagatgctgcatttctggcccgggagaaggcaaaggcagatgct
gagtgctacactgctatgaaaatagccgaagccaataagctgaagctaacccctgaatat
ctgcagctgatgaagtacaaggccattgcttccaacagcaagatttactttggcaaagac
attcctaacatgttcatggactctgcgggcagtgtgagcaagcagtttgaggggctagct
gacaagctaagctttggcttagaagatgaacccttggagacggccactaaggagaattga

DBGET integrated database retrieval system