KEGG   Homo sapiens (human): 11162
Entry
11162             CDS       T01001                                 
Symbol
NUDT6, ASFGF2, FGF-AS, FGF2AS, GFG-1, GFG1
Name
(RefSeq) nudix hydrolase 6
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Nudix_hydro NUDIX NUDIX_4 DUF5763
Other DBs
NCBI-GeneID: 11162
NCBI-ProteinID: NP_009014
OMIM: 606261
HGNC: 8053
Ensembl: ENSG00000170917
UniProt: P53370
Position
4:complement(122892577..122922968)
AA seq 316 aa
MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRL
ARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAES
DSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEP
EEDIGDTAVREVFEETGIKSEFRSVLSIRQQHTNPGAFGKSDMYIICRLKPYSFTINFCQ
EECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFDKIDLTVEELPAVYTGLFYKL
YHKELPENYKTMKGID
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcggcagccactgagctggggccgctggcgcgcgatgcttgcccgaacctacggcccc
gggccttcggcgggttaccgctgggcctcgggcgcacagggttacgtgcggaatccgcca
gttggagcgtgcgatctgcagggcgagctggacagattcgggggcatctcggtgcgcctg
gcgcggctcgatgcgctggaccgcctggacgctgccgccttccagaagggcttgcaggct
gcagtacagcaatggcgatcagaaggtagaacagctgtatggctgcacattcccatcctc
caaagccgatttattgcccctgctgcttccctgggcttctgctttcaccacgcagaatcg
gattcatcaacgttgactctgtggctgagagaagggcccagcagattaccaggatatgct
tcacatcaagtaggagttgcaggagctgtatttgatgaaagtactagaaaaatactggtt
gtacaagatcgaaataaattgaaaaatatgtggaagtttccaggaggcctgtcagagcct
gaagaagatattggagacacagcggttcgagaagtttttgaagagactggtataaaatca
gaattcaggtccgtcctgagtattcggcaacagcacacaaatcctggagcttttgggaag
tcagatatgtatatcatctgccgcctaaagccatattcattcaccataaatttttgccag
gaagaatgcttaagatgtgagtggatggatctcaatgacctggcgaagactgaaaataca
actcccatcaccagcagagttgctaggctgctgctgtatgggtacagagaagggtttgac
aaaattgacctgactgtggaagaacttccagcagtttacacaggactgttttataaactc
tatcataaggaactgccagagaattataaaactatgaaaggaattgattaa

DBGET integrated database retrieval system