KEGG   Homo sapiens (human): 11163
Entry
11163             CDS       T01001                                 
Symbol
NUDT4, DIPP-2B, DIPP2, DIPP2alpha, DIPP2beta, HDCMB47P, NUDT4B
Name
(RefSeq) nudix hydrolase 4
  KO
K07766  diphosphoinositol-polyphosphate diphosphatase [EC:3.6.1.52]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    11163 (NUDT4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.52  diphosphoinositol-polyphosphate diphosphatase
     11163 (NUDT4)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 11163
NCBI-ProteinID: NP_061967
OMIM: 609229
HGNC: 8051
Ensembl: ENSG00000173598
UniProt: Q9NZJ9
Position
12:93377925..93408146
AA seq 180 aa
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPG
GAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWF
KVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatgaagttcaagcccaaccagacgcggacctacgaccgcgagggcttcaagaagcgg
gcggcgtgcctgtgcttccggagcgagcaggaggacgaggtgctgctggtgagtagcagc
cggtacccagaccagtggattgtcccaggaggaggaatggaacccgaggaggaacctggc
ggtgctgccgtgagggaagtttatgaggaggctggagtcaaaggaaaactaggcagactt
ctgggcatatttgagaaccaagaccgaaagcacagaacatatgtttatgttctaacagtc
actgaaatattagaagattgggaagattctgttaatattggaaggaagagagagtggttc
aaagtagaagatgctatcaaagttctccagtgtcataaacctgtacatgcagagtatctg
gaaaagctaaagctgggttgttccccagccaatggaaattctacagtcccttcccttccg
gataataatgccttgtttgtaaccgctgcacagacctctgggttgccatctagtgtaaga
tag

DBGET integrated database retrieval system