KEGG   Homo sapiens (human): 11164
Entry
11164             CDS       T01001                                 
Symbol
NUDT5, YSA1, YSA1H, YSAH1, hNUDT5
Name
(RefSeq) nudix hydrolase 5
  KO
K13987  ADP-ribose diphosphatase / 8-oxo-dGDP phosphatase / ADP-D-ribose pyrophosphorylase [EC:3.6.1.13 3.6.1.58 2.7.7.96]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11164 (NUDT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.96  ADP-D-ribose pyrophosphorylase
     11164 (NUDT5)
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     11164 (NUDT5)
    3.6.1.58  8-oxo-dGDP phosphatase
     11164 (NUDT5)
SSDB
Motif
Pfam: NUDIX PP1
Other DBs
NCBI-GeneID: 11164
NCBI-ProteinID: NP_054861
OMIM: 609230
HGNC: 8052
Ensembl: ENSG00000165609
UniProt: Q9UKK9
Position
10:complement(12165330..12195891)
AA seq 219 aa
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTAD
GVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYK
GDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQ
RLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
NT seq 660 nt   +upstreamnt  +downstreamnt
atggagagccaagaaccaacggaatcttctcagaatggcaaacagtatatcatttcagag
gagttaatttcagaaggaaaatgggtcaagcttgaaaaaacaacgtacatggatcctact
ggtaaaactagaacttgggaatcagtgaaacgtacaaccaggaaagagcagactgcggat
ggtgtcgcggtcatccccgtgctgcagagaacacttcactatgagtgtatcgttctggtg
aaacagttccgaccaccaatggggggctactgcatagagttccctgcaggtctcatagat
gatggtgaaaccccagaagcagctgctctccgggagcttgaagaagaaactggctacaaa
ggggacattgccgaatgttctccagcggtctgtatggacccaggcttgtcaaactgtact
atacacatcgtgacagtcaccattaacggagatgatgccgaaaacgcaaggccgaagcca
aagccaggggatggagagtttgtggaagtcatttctttacccaagaatgacctgctgcag
agacttgatgctctggtagctgaagaacatctcacagtggacgccagggtctattcctac
gctctagcactgaaacatgcaaatgcaaagccatttgaagtgcccttcttgaaattttaa

DBGET integrated database retrieval system