KEGG   Homo sapiens (human): 11173
Entry
11173             CDS       T01001                                 

Gene name
ADAMTS7, ADAM-TS_7, ADAM-TS7, ADAMTS-7
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 7
  KO
K08622  a disintegrin and metalloproteinase with thrombospondin motifs 7 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    11173 (ADAMTS7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11173 (ADAMTS7)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   11173 (ADAMTS7)
SSDB
Motif
Pfam: TSP1_ADAMTS Pep_M12B_propep ADAM_spacer1 TSP_1 Reprolysin ADAM_CR_2 Reprolysin_5 TSP1_CCN TSP1_spondin Reprolysin_3 Reprolysin_2 Reprolysin_4 PLAC
Other DBs
NCBI-GeneID: 11173
NCBI-ProteinID: NP_055087
OMIM: 605009
HGNC: 223
Ensembl: ENSG00000136378
Vega: OTTHUMG00000172907
Pharos: Q9UKP4(Tbio)
UniProt: Q9UKP4 Q9UFZ4
Position
15q25.1
AA seq 1686 aa
MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGRATEGRAALDIVHPVRVDAGGSFLSY
ELWPRALRKRDVSVRRDAPAFYELQYRGRELRFNLTANQHLLAPGFVSETRRRGGLGRAH
IRAHTPACHLLGEVQDPELEGGLAAISACDGLKGVFQLSNEDYFIEPLDSAPARPGHAQP
HVVYKRQAPERLAQRGDSSAPSTCGVQVYPELESRRERWEQRQQWRRPRLRRLHQRSVSK
EKWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLVLLEDE
EEDLKITHHADNTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAMNRPCETLGLS
HVAGMCQPHRSCSINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLL
YDAAPLTWSRCSRQYITRFLDRGWGLCLDDPPAKDIIDFPSVPPGVLYDVSHQCRLQYGA
YSAFCEDMDNVCHTLWCSVGTTCHSKLDAAVDGTRCGENKWCLSGECVPVGFRPEAVDGG
WSGWSAWSICSRSCGMGVQSAERQCTQPTPKYKGRYCVGERKRFRLCNLQACPAGRPSFR
HVQCSHFDAMLYKGQLHTWVPVVNDVNPCELHCRPANEYFAEKLRDAVVDGTPCYQVRAS
RDLCINGICKNVGCDFEIDSGAMEDRCGVCHGNGSTCHTVSGTFEEAEGLGYVDVGLIPA
GAREIRIQEVAEAANFLALRSEDPEKYFLNGGWTIQWNGDYQVAGTTFTYARRGNWENLT
SPGPTKEPVWIQLLFQESNPGVHYEYTIHREAGGHDEVPPPVFSWHYGPWTKCTVTCGRG
VQRQNVYCLERQAGPVDEEHCDPLGRPDDQQRKCSEQPCPARWWAGEWQLCSSSCGPGGL
SRRAVLCIRSVGLDEQSALEPPACEHLPRPPTETPCNRHVPCPATWAVGNWSQCSVTCGE
GTQRRNVLCTNDTGVPCDEAQQPASEVTCSLPLCRWPLGTLGPEGSGSGSSSHELFNEAD
FIPHHLAPRPSPASSPKPGTMGNAIEEEAPELDLPGPVFVDDFYYDYNFINFHEDLSYGP
SEEPDLDLAGTGDRTPPPHSHPAAPSTGSPVPATEPPAAKEEGVLGPWSPSPWPSQAGRS
PPPPSEQTPGNPLINFLPEEDTPIGAPDLGLPSLSWPRVSTDGLQTPATPESQNDFPVGK
DSQSQLPPPWRDRTNEVFKDDEEPKGRGAPHLPPRPSSTLPPLSPVGSTHSSPSPDVAEL
WTGGTVAWEPALEGGLGPVDSELWPTVGVASLLPPPIAPLPEMKVRDSSLEPGTPSFPTP
GPGSWDLQTVAVWGTFLPTTLTGLGHMPEPALNPGPKGQPESLSPEVPLSSRLLSTPAWD
SPANSHRVPETQPLAPSLAEAGPPADPLVVRNAGWQAGNWSECSTTCGLGAVWRPVRCSS
GRDEDCAPAGRPQPARRCHLRPCATWHSGNWSKCSRSCGGGSSVRDVQCVDTRDLRPLRP
FHCQPGPAKPPAHRPCGAQPCLSWYTSSWRECSEACGGGEQQRLVTCPEPGLCEEALRPN
TTRPCNTHPCTQWVVGPWGQCSGPCGGGVQRRLVKCVNTQTGLPEEDSDQCGHEAWPESS
RPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGH
QRVARR
NT seq 5061 nt   +upstreamnt  +downstreamnt
atgcccggcggccccagtccccgcagccccgcgcctttgctgcgccccctcctcctgctc
ctctgcgctctggctcccggcgcccccggacccgcaccaggacgtgcaaccgagggccgg
gcggcactggacatcgtgcacccggttcgagtcgacgcggggggctccttcctgtcctac
gagctgtggccccgcgcactgcgcaagcgggatgtatctgtgcgccgagacgcgcccgcc
ttctacgagctacaataccgcgggcgcgagctgcgcttcaacctgaccgccaatcagcac
ctgctggcgcccggctttgtgagcgagacgcggcggcgcggcggcctgggccgcgcgcac
atccgggcccacaccccggcctgccacctgcttggcgaggtgcaggaccctgagctcgag
ggtggcctggcggccatcagcgcctgcgacggcctgaaaggtgtgttccagctctccaac
gaggactacttcattgagcccctggacagtgccccggcccggcctggccacgcccagccc
catgtggtgtacaagcgtcaggccccggagaggctggcacagcggggtgattccagtgct
ccaagcacctgtggagtgcaagtgtacccagagctggagtctcgacgggagcgttgggag
cagcggcagcagtggcggcggccacggctgaggcgtctacaccagcggtcggtcagcaaa
gagaagtgggtggagaccctggtagtagctgatgccaaaatggtggagtaccacggacag
ccgcaggttgagagctatgtgctgaccatcatgaacatggtggctggcctgtttcatgac
cccagcattgggaaccccatccacatcaccattgtgcgcctggtcctgctggaagatgag
gaggaggacctaaagatcacgcaccatgcagacaacaccctgaagagcttctgcaagtgg
cagaaaagcatcaacatgaagggggatgcccatcccctgcaccatgacactgccatcctg
ctcaccagaaaggacctgtgtgcagccatgaaccggccctgtgagaccctgggactgtcc
catgtggcgggcatgtgccagccgcaccgcagctgcagcatcaacgaggacacgggcctg
ccgctggccttcactgtagcccacgagctcgggcacagttttggcattcagcatgacgga
agcggcaatgactgtgagcccgttgggaaacgacctttcatcatgtctccacagctcctg
tacgacgccgctcccctcacctggtcccgctgcagccgccagtatatcaccaggttcctt
gaccgtgggtggggcctgtgcctggacgaccctcctgccaaggacattatcgacttcccc
tcggtgccacctggcgtcctctatgatgtaagccaccagtgccgcctccagtacggggcc
tactctgccttctgcgaggacatggataatgtctgccacacactctggtgctctgtgggg
accacctgtcactccaagctggatgcagctgtggacggcacccggtgtggggagaataag
tggtgtctcagtggggagtgcgtacccgtgggcttccggcccgaggccgtggatggtggc
tggtctggctggagcgcctggtccatctgctcacggagctgtggcatgggcgtacagagc
gccgagcggcagtgcacgcagcctacgcccaaatacaaaggcagatactgtgtgggtgag
cgcaagcgcttccgcctctgcaacctgcaggcctgccctgctggccgcccctccttccgc
cacgtccagtgcagccactttgacgctatgctctacaagggccagctgcacacatgggtg
cccgtggtcaatgacgtgaacccctgcgagctgcactgccggcccgcgaatgagtacttt
gccgagaagctgcgggacgccgtggtcgatggcaccccctgctaccaggtccgagccagc
cgggacctctgcatcaacggcatctgtaagaacgtgggctgtgacttcgagattgactcc
ggtgctatggaggaccgctgtggtgtgtgccacggcaacggctccacctgccacaccgtg
agcgggaccttcgaggaggccgagggcctggggtatgtggatgtggggctgatcccagcg
ggcgcacgcgagatccgcatccaagaggttgccgaggctgccaacttcctggcactgcgg
agcgaggacccggagaagtacttcctcaatggtggctggaccatccagtggaacggggac
taccaggtggcagggaccaccttcacatacgcacgcaggggcaactgggagaacctcacg
tccccgggtcccaccaaggagcctgtctggatccagctgctgttccaggagagcaaccct
ggggtgcactacgagtacaccatccacagggaggcaggtggccacgacgaggtcccgccg
cccgtgttctcctggcattatgggccctggaccaagtgcacagtcacctgcggcagaggt
gtgcagaggcagaatgtgtactgcttggagcggcaggcagggcccgtggacgaggagcac
tgtgaccccctgggccggcctgatgaccaacagaggaagtgcagcgagcagccctgccct
gccaggtggtgggcaggtgagtggcagctgtgctccagctcctgcgggcctgggggcctc
tcccgccgggccgtgctctgcatccgcagcgtggggctggatgagcagagcgccctggag
ccacccgcctgtgaacaccttccccggccccctactgaaaccccttgcaaccgccatgta
ccctgtccggccacctgggctgtggggaactggtctcagtgctcagtgacatgtggggag
ggcactcagcgccgaaatgtcctctgcaccaatgacaccggtgtcccctgtgacgaggcc
cagcagccagccagcgaagtcacctgctctctgccactctgtcggtggcccctgggcaca
ctgggccctgaaggctcaggcagcggctcctccagccacgagctcttcaacgaggctgac
ttcatcccgcaccacctggccccacgcccttcacccgcctcatcacccaagccaggcacc
atgggcaacgccattgaggaggaggctccagagctggacctgccggggcccgtgtttgtg
gacgacttctactacgactacaatttcatcaatttccacgaggatctgtcctacgggccc
tctgaggagcccgatctagacctggcggggacaggggaccggacacccccaccacacagc
catcctgctgcgccctccacgggtagccccgtgcctgccacagagcctcctgcagccaag
gaggagggggtactgggaccttggtccccgagcccttggcctagccaggccggccgctcc
ccacccccaccctcagagcagacccctgggaaccctttgatcaatttcctgcctgaggaa
gacacccccataggggccccagatcttgggctccccagcctgtcctggcccagggtttcc
actgatggcctgcagacacctgccacccctgagagccaaaatgatttcccagttggcaag
gacagccagagccagctgccccctccatggcgggacaggaccaatgaggttttcaaggat
gatgaggaacccaagggccgaggagcaccccacctgcccccgagacccagctccacgctg
ccccctttgtcccctgttggcagcacccactcctctcctagtcctgacgtggcggagctg
tggacaggaggcacagtggcctgggagccagctctggagggtggcctggggcctgtggac
agtgaactgtggcccactgttggggtggcttctctccttcctcctcccatagcccctctg
ccagagatgaaggtcagggacagttccctggagccggggactccctccttcccaacccca
ggaccaggctcatgggacctgcagactgtggcagtgtgggggaccttcctccccacaacc
ctgactggcctcgggcacatgcctgagcctgccctgaacccaggacccaagggtcagcct
gagtccctcagccctgaggtgcccctgagctctaggctgctgtccacaccagcttgggac
agccccgccaacagccacagagtccctgagacccagccgctggctcccagcctggctgaa
gcggggccccccgcggacccgttggttgtcaggaacgccggctggcaagcgggaaactgg
agcgagtgctctaccacctgtggcctgggtgcggtctggaggccggtgcgctgtagctcc
ggccgggatgaggactgcgcccccgctggccggccccagcctgcccgccgctgccacctg
cggccctgtgccacctggcactcaggcaactggagtaagtgctcccgcagctgcggcgga
ggttcctcagtgcgggacgtgcagtgtgtggacacacgggacctccggccactgcggccc
ttccattgtcagcccgggcctgccaagccgcctgcgcaccggccctgcggggcccagccc
tgcctcagctggtacacatcttcctggagggagtgctccgaggcctgtggcggtggtgag
cagcagcgtctagtgacctgcccggagccaggcctctgcgaggaggcgctgagacccaac
accacccggccctgcaacacccacccctgcacgcagtgggtggtggggccctggggccag
tgctcaggcccctgtggtggtggtgtccagcggcgcctggtcaagtgtgtcaacacccag
acagggctgcccgaggaagacagtgaccagtgtggccacgaggcctggcctgagagctcc
cggccgtgtggcaccgaggattgtgagcccgtcgagcctccccgctgtgagcgggaccgc
ctgtccttcgggttctgcgagacgctgcgcctactgggccgctgccagctgcccaccatc
cgcacccagtgctgccgctcgtgctctccgcccagccacggcgccccctcccgaggccat
cagcgggttgcccgccgctga

DBGET integrated database retrieval system