KEGG   Homo sapiens (human): 11174Help
Entry
11174             CDS       T01001                                 

Gene name
ADAMTS6, ADAM-TS_6, ADAM-TS6, ADAMTS-6
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 6
  KO
K08621  a disintegrin and metalloproteinase with thrombospondin motifs 6 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    11174 (ADAMTS6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11174 (ADAMTS6)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   11174 (ADAMTS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep_M12B_propep ADAM_spacer1 Reprolysin TSP_1 ADAM_CR_2 Reprolysin_5 Reprolysin_3 PLAC Reprolysin_2 Reprolysin_4 Peptidase_M57 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 11174
NCBI-ProteinID: NP_922932
OMIM: 605008
HGNC: 222
Ensembl: ENSG00000049192
Vega: OTTHUMG00000074079
Pharos: Q9UKP5(Tdark)
UniProt: Q9UKP5 Q5IR90
Position
5q12.3
AA seq 1117 aa AA seqDB search
MEILWKTLTWILSLIMASSEFHSDHRLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFT
VKNDKHSRRRRSMDPIDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDG
PQWKHDFLDNCHYTGYLQDQRSTTKVALSNCVGLHGVIATEDEEYFIEPLKNTTEDSKHF
SYENGHPHVIYKKSALQQRHLYDHSHCGVSDFTRSGKPWWLNDTSTVSYSLPINNTHIHH
RQKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMNIVAKLYRDSSLGNVVNIIVA
RLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHHDNAVLITRYD
ICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNSC
GTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAP
GQVYDADEQCRFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGNIEKG
WCYQGDCVPFGTWPQSIDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLGE
RKRYRSCNTDPCPLGSRDFREKQCADFDNMPFRGKYYNWKPYTGGGVKPCALNCLAEGYN
FYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSDAREDRCRVCGGDGSTCDAIE
GFFNDSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYINGAWTIDWPRKF
DVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNEV
GFTWNHQPWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTEPCP
PEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPVEKEPCNNQSCP
PQWVALDWSECTPKCGPGFKHRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPP
RWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASSDCLETVRPPSMQQCESKCDSTPISNT
EECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttgtggaagacgttgacctggattttgagcctcatcatggcttcatcggaa
tttcatagtgaccacaggctttcatacagttctcaagaggaattcctgacttatcttgaa
cactaccagctaactattccaataagggttgatcaaaatggagcatttctcagctttact
gtgaaaaatgataaacactcaaggagaagacggagtatggaccctattgatccacagcag
gcagtatctaagttattttttaaactttcagcctatggcaagcactttcatctaaacttg
actctcaacacagattttgtgtccaaacattttacagtagaatattgggggaaagatgga
ccccagtggaaacatgattttttagacaactgtcattacacaggatatttgcaagatcaa
cgtagtacaactaaagtggctttaagcaactgtgttgggttgcatggtgttattgctaca
gaagatgaagagtattttatcgaacctttaaagaataccacagaggattccaagcatttt
agttatgaaaatggccaccctcatgttatttacaaaaagtctgcccttcaacaacgacat
ctgtatgatcactctcattgtggggtttcggatttcacaagaagtggcaaaccttggtgg
ctgaatgacacatccactgtttcttattcactaccaattaacaacacacatatccaccac
agacagaagagatcagtgagcattgaacggtttgtggagacattggtagtggcagacaaa
atgatggtgggctaccatggccgcaaagacattgaacattacattttgagtgtgatgaat
attgttgccaaactttaccgtgattccagcctaggaaacgttgtgaatattatagtggcc
cgcttaattgttctcacagaagatcagccaaacttggagataaaccaccatgcagacaag
tccctcgatagcttctgtaaatggcagaaatccattctctcccaccaaagtgatggaaac
accattccagaaaatgggattgcccaccacgataatgcagttcttattactagatatgat
atctgcacttataaaaataagccctgtggaacactgggcttggcctctgtggctggaatg
tgtgagcctgaaaggagctgcagcattaatgaagacattggcctgggttcagcttttacc
attgcacatgagattggtcacaattttggtatgaaccatgatggaattggaaattcttgt
gggacgaaaggtcatgaagcagcaaaacttatggcagctcacattactgcgaataccaat
cctttttcctggtctgcttgcagtcgagactacatcaccagctttctagattcaggccgt
ggtacttgccttgataatgagcctcccaagcgtgactttctttatccagctgtggcccca
ggtcaggtgtatgatgctgatgagcaatgtcgtttccagtatggagcaacctcccgccaa
tgtaaatatggggaagtgtgtagagagctctggtgtctcagcaaaagcaaccgctgtgtc
accaacagtattccagcagctgaggggacactgtgtcaaactgggaatattgaaaaaggg
tggtgttatcagggagattgtgttccttttggcacttggccccagagcatagatgggggc
tggggtccctggtcactatggggagagtgcagcaggacctgcgggggaggcgtctcctca
tccctaagacactgtgacagtccagcaccttcaggaggtggaaaatattgccttggggaa
aggaaacggtatcgctcctgtaacacagatccatgccctttgggttcccgagattttcga
gagaaacagtgtgcagactttgacaatatgcctttccgaggaaagtattataactggaaa
ccctatactggaggtggggtaaaaccttgtgcattaaactgcttggctgaaggttataat
ttctacactgaacgtgctcctgcggtgatcgatgggacccagtgcaatgcggattcactg
gatatctgcatcaatggagaatgcaagcacgtaggctgtgataatattttgggatctgat
gctagggaagatagatgtcgagtctgtggaggggacggaagcacatgtgatgccattgaa
gggttcttcaatgattcactgcccaggggaggctacatggaagtggtgcagataccaaga
ggctctgttcacattgaagttagagaagttgccatgtcaaagaactatattgctttaaaa
tctgaaggagatgattactatattaatggtgcctggactattgactggcctaggaaattt
gatgttgctgggacagcttttcattacaagagaccaactgatgaaccagaatccttggaa
gctctaggtcctacctcagaaaatctcatcgtcatggttctgcttcaagaacagaatttg
ggaattaggtataagttcaatgttcccatcactcgaactggcagtggagataatgaagtt
ggctttacatggaatcatcagccttggtcagaatgctcagctacttgtgctggaggtgtc
caaagacaggaggtggtctgtaaaaggttggatgacaactccattgtccagaacaattac
tgtgatcctgacagtaagccacctgaaaatcaaagagcctgcaacactgagccctgccca
cctgagtggttcattggggattggttggaatgcagcaagacttgtgatggtgggatgcgc
acaagggcagtgctctgcatcaggaagatcggaccttctgaggaggagacgctggactac
agtggttgtttaacacaccggcctgtcgaaaaagagccctgcaacaaccagtcatgtcca
ccacagtgggtggctttggactggtctgagtgtactccaaaatgtggtccaggattcaag
catcggattgttctgtgcaagagcagtgacctttctaagacattcccagctgcacaatgt
ccagaggaaagcaaacctcctgtccgcatccgctgcagtttgggccgctgccctcctcct
cgctgggtcacaggagactggggccagtgttctgctcagtgtggccttggacagcagatg
agaactgtgcagtgtctctcctacaccggacaggcatctagtgactgtctagaaactgtt
cggcctccatcaatgcagcagtgtgaaagcaaatgtgacagtacccccatttctaatact
gaagagtgcaaagatgtgaataaagtggcttattgcccactggtgctgaagttcaagttc
tgcagtcgagcatacttcagacagatgtgttgtaagacctgccaaggacactga

DBGET integrated database retrieval system