KEGG   Homo sapiens (human): 11176Help
Entry
11176             CDS       T01001                                 

Gene name
BAZ2A, TIP5, WALp3
Definition
(RefSeq) bromodomain adjacent to zinc finger domain 2A
  KO
K15224  bromodomain adjacent to zinc finger domain protein 2A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    11176 (BAZ2A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    NoRC (nucleolar remodeling complex)
     11176 (BAZ2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBD Bromodomain WSD PHD DDT WHIM1
Motif
Other DBs
NCBI-GeneID: 11176
NCBI-ProteinID: NP_038477
OMIM: 605682
HGNC: 962
Ensembl: ENSG00000076108
Vega: OTTHUMG00000170332
Pharos: Q9UIF9(Tchem)
UniProt: Q9UIF9
Structure
PDB: 

Position
12q13.3
AA seq 1905 aa AA seqDB search
MEMEANDHFNFTGLPPAPAASGLKPSPSSGEGLYTNGSPMNFPQQGKSLNGDVNVNGLST
VSHTTTSGILNSAPHSSSTSHLHHPSVAYDCLWNYSQYPSANPGSNLKDPPLLSQFSGGQ
YPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMP
NGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLEL
EEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILSEDSLE
PFNSLAPEPVSGGLYGIDDTELMGAEDKLPLEDSPVISALDCPSLNNATAFSLLADDSQT
STSIFASPTSPPVLGESVLQDNSFDLNNGSDAEQEEMETQSSDFPPSLTQPAPDQSSTIQ
LHPATSPAVSPTTSPAVSLVVSPAASPEISPEVCPAASTVVSPAVFSVVSPASSAVLPAV
SLEVPLTASVTSPKASPVTSPAAAFPTASPANKDVSSFLETTADVEEITGEGLTASGSGD
VMRRRIATPEEVRLPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIKYLSRN
VVHSVRREHFSFSPRMPVGDFFEERDTPEGLQWVQLSAEEIPSRIQAITGKRGRPRNTEK
AKTKEVPKVKRGRGRPPKVKITELLNKTDNRPLKKLEAQETLNEEDKAKIAKSKKKMRQK
VQRGECQTTIQGQARNKRKQETKSLKQKEAKKKSKAEKEKGKTKQEKLKEKVKREKKEKV
KMKEKEEVTKAKPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSR
VPGLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQGDSLGEVQDLL
VRLLKAALHDPGFPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGVEPALCDRLRT
QPFQAQPPQQKAAVLAFLVHELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVL
AKRTGRSEVEMEGPEECLGRRRSSRIMEETSGMEEEEEEESIAAVPGRRGRRDGEVDATA
SSIPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVEGTE
GNLVPEEVIKKETDSLKVAAHASLNPALFSMKMELAGSNTTASSPARARGRPRKTKPGSM
QPRHLKSPVRGQDSEQPQAQLQPEAQLHAPAQPQPQLQLQLQSHKGFLEQEGSPLSLGQS
QHDLSQSAFLSWLSQTQSHSSLLSSSVLTPDSSPGKLDPAPSQPPEEPEPDEAESSPDPQ
ALWFNISAQMPCNAAPTPPPAVSEDQPTPSPQQLASSKPMNRPSAANPCSPVQFSSTPLA
GLAPKRRAGDPGEMPQSPTGLGQPKRRGRPPSKFFKQMEQRYLTQLTAQPVPPEMCSGWW
WIRDPEMLDAMLKALHPRGIREKALHKHLNKHRDFLQEVCLRPSADPIFEPRQLPAFQEG
IMSWSPKEKTYETDLAVLQWVEELEQRVIMSDLQIRGWTCPSPDSTREDLAYCEHLSDSQ
EDITWRGRGREGLAPQRKTTNPLDLAVMRLAALEQNVERRYLREPLWPTHEVVLEKALLS
TPNGAPEGTTTEISYEITPRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVTCL
VCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPK
RGQKRKSGYSLNFSEGDGRRRRVLLRGRESPAAGPRYSEEGLSPSKRRRLSMRNHHSDLT
FCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAA
DALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFYQGKQANL
NT seq 5718 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggaggcaaacgaccattttaactttactggccttccccctgcacctgctgcc
tcaggactgaaaccctctccttcctcaggggagggcctctacactaacgggtctcccatg
aacttcccccagcaagggaaaagtttgaatggggatgtgaatgttaatggcttatctact
gtatctcacactactacttcagggattttgaactctgctccccactcctccagcacctca
cacctccatcaccccagcgtggcctacgactgtctctggaactactcacagtacccatct
gccaatcctggcagcaacctcaaggacccaccccttctctcccagttctcggggggacaa
tacccactcaacggcatccttgggggcagccggcaaccttcatccccaagtcataacact
aaccttcgggctgggagccaagagttctgggccaacggtacccagagtcccatggggctt
aactttgattcacaagaactgtatgattcctttcctgaccagaattttgaggtgatgccc
aatggaccccctagttttttcacctccccacagacttctcctatgttgggatctagcatt
caaacctttgcaccctcccaggaggtaggcagtggtatccatcctgatgaggcagcagaa
aaggagatgacttcagttgtggcagagaatggcactggcttggtaggcagcttggagctg
gaagaagagcagccagaactgaagatgtgtggctacaatggctctgtcccttctgtggaa
tcgttacaccaagaggtctcagtcctggtccctgaccccacagtgagctgtttagatgat
ccttcacatcttcctgatcaactggaagacactccaatcctcagtgaagactctctggag
cccttcaactctctggcaccagagccagtgagtggaggactatatggtattgatgacacg
gagctgatgggtgcagaggacaagctgcctcttgaggacagccctgtgatttctgccctt
gattgcccttccctcaataatgctactgccttcagtctcctggcagatgatagtcaaaca
tcaacctctatctttgccagtcccacctctccacctgtcctaggggagtctgtcctgcaa
gataacagctttgacctgaataatggtagtgacgctgaacaggaagaaatggaaactcaa
tcttcagacttcccaccatccctgacccagccagctcctgatcagtcatccactattcag
ctacatccagcaacctcaccagcagtctcgccaacaacctccccagcagtctccctagtg
gtttctccagcagcctccccagaaatctctccagaagtttgtcccgcagcttctacagtt
gtctctccagcagtcttctcagtggtctctccagcttcctcagcagtcctcccagcagtc
tccttagaagtcccgttgacggcttcagtgacatccccaaaagcctctcccgtaacttcc
ccagcagctgcctttccaacagcctccccagcaaataaggatgtcagcagctttctagaa
accactgctgacgtggaagagatcactggagaaggactcactgcttctggtagtggtgat
gtcatgaggagacgtattgctaccccagaagaagttcgtcttcccctccaacatgggtgg
cggagagaggtgcgcatcaagaagggcagccaccgatggcagggggagacctggtattat
ggcccctgtgggaagaggatgaagcaatttccagaagtgatcaagtacctgagccgcaac
gtggtacacagtgtccgccgagagcacttcagcttcagtccccgtatgcctgttggagat
ttctttgaagaaagagacacgccagagggcttgcagtgggtgcagctctcagcagaggag
atcccgtcgaggattcaggcaattactggcaaacggggtcgacctcgaaacactgagaag
gctaagactaaggaagtccccaaggtgaaacggggtcgaggtcggccacctaaggtcaaa
atcactgagctattgaacaagacagacaaccgccccctaaagaaactggaggcccaagaa
acattgaatgaggaggataaagcaaagattgctaaaagcaagaagaagatgaggcagaag
gttcaacggggagagtgtcagactactatccaagggcaggccagaaataagcggaaacaa
gagaccaagagcttaaagcagaaggaagctaagaagaaatccaaggctgagaaagaaaaa
ggaaagacaaagcaggaaaaactgaaggaaaaagtcaagagggaaaagaaggagaaggta
aaaatgaaggaaaaggaggaggtgaccaaagccaagccagcctgtaaagcagataagacc
ctggccacacagaggcgcttggaggaacggcagaggcagcagatgatcttggaggaaatg
aagaagccgacagaggatatgtgtctgactgaccaccagcccctgcctgacttctcacga
gtccctggtctgacattgcccagtggagccttctcagactgcttgaccattgtggagttc
ctgcatagctttggcaaggtgctgggctttgatcctgccaaagatgtgcctagcctgggg
gtcctgcaggagggactcctgtgtcaaggtgacagcttgggtgaggtgcaagacctgctg
gtcaggctgctgaaggctgcactccatgatcctggctttccctcctactgtcagtcccta
aagatcttgggggagaaggtgtctgagatcccactgacaagagacaatgtgtcagagatc
ctgcgctgcttccttatggcatatggagtagagccagccctctgtgaccgcctgcgcacc
cagccttttcaggcccagccaccccagcagaaggctgctgtcctggccttccttgtgcat
gagctcaatggctccaccctcatcatcaatgagattgacaagactctggagagtatgtcc
agctacaggaaaaacaagtggattgttgaaggccggctccggaggctgaaaactgttctg
gccaagcgaactgggcggtctgaagtagagatggaagggccagaggaatgcctgggacgg
aggcgcagttctcggatcatggaggagaccagtggcatggaagaagaggaagaagaggag
tctatagcagctgtccctggccgcaggggtcgaagagatggagaggttgatgccacagca
tctagcatcccagagctagagcgccagatagaaaaactcagcaagcgtcagcttttcttt
cgcaaaaagctgcttcactcatcccagatgcttcgggcggtctccctgggtcaggaccgc
tacagacgtcgctactgggtattgccgtatttggctggtatctttgtagaaggaacagag
gggaacttagttcctgaggaggtgataaagaaggaaactgactccttaaaagtggcagcc
catgcgtcactcaaccctgccctcttctctatgaagatggagttagctggctccaacacc
actgccagttctcctgcccgggcccgaggccgacctcgaaaaactaagcccgggtctatg
caacctaggcatcttaagtcccctgtcaggggtcaggattcagaacagccccaggcccag
cttcagcctgaggctcagcttcatgctcctgcccagccccagcctcagcttcagcttcag
cttcagtcccataaggggttcctggagcaagaaggctcccctttgtcactgggtcagagc
cagcatgacctcagccagtcagccttcctgtcttggctgagccagactcagagccatagc
tccctgttgagcagctcagtcctcacacctgatagcagtccgggaaaactagacccagct
ccatcacaacccccggaggagccagagcctgatgaggcagaatccagccctgatcctcaa
gcactctggtttaacatctcagcccagatgccctgcaatgctgcccccacaccgccccct
gcagtttctgaggaccaacccactccctcccctcagcagcttgcctcctccaagccaatg
aatagacctagtgctgccaacccttgttctccagtgcagttctcttccacgcccttggct
gggttggcccctaagaggcgagcaggagaccctggagaaatgccacagagtcccacaggg
ctgggacagcccaaacggagagggagacctcccagtaagttcttcaaacagatggaacag
cgttacctaacccagctgacagcccagcctgtcccacctgagatgtgctcaggctggtgg
tggatacgagatcctgagatgttggatgccatgctcaaggccctacacccccgaggtatc
cgggagaaggcacttcacaaacaccttaacaagcacagggacttcttgcaggaagtctgc
ctgcggccctcagctgaccccatctttgagcccaggcaactacctgcctttcaagaaggg
attatgagctggtcccccaaagagaagacatacgagacagacctagcagtgcttcaatgg
gtagaggagctggagcagcgggttatcatgtctgatctgcagattcggggctggacatgt
cctagcccagactctacccgtgaagacttggcctactgtgagcacctctccgactcccag
gaggatatcacctggcgaggtcggggcagggagggactggcacctcagcgtaaaactacc
aaccctttggacctggctgtgatgcggctggctgccctggaacagaatgtagaacggcgg
tacctgcgggagcccctctggccaactcatgaggttgtgctggagaaggccctgcttagc
acacctaatggtgcccctgagggcaccactacagagatatcatatgagatcacccctcgc
attcgtgtctggcgccagaccctcgagcggtgccggagcgcagcccaggtgtgcttgtgc
ctgggccagctggagaggtccattgcctgggagaagtctgtcaacaaagtgacatgtcta
gtctgccggaagggtgacaatgatgagtttcttctgctttgtgatgggtgtgaccgtggc
tgccacatttactgccatcgtcccaagatggaggctgtcccagaaggagattggttctgt
actgtctgtttggctcagcaggtggagggagaattcactcagaagcctggtttcccaaag
cgtggccagaagcggaaaagtggttattcgctgaacttctcagagggtgatggccgccga
cgccgggtactgttgaggggccgagaaagcccagcagcagggcctcggtactcggaagaa
gggctctccccctccaagcggcggcgactctctatgcggaaccaccacagtgatctcaca
ttttgcgagattatcctgatggagatggagtcccatgatgcagcctggcctttcctagag
cctgtgaacccacgtttggtgagtgggtaccggcgcatcatcaaaaatcctatggatttt
tccaccatgcgggagcggctgctcaggggagggtacaccagctcagaggagtttgcggct
gatgccctcctggtatttgacaactgccagactttcaacgaggatgactctgaagtaggc
aaggctgggcacatcatgcgccgcttcttcgagagccgctgggaggagttttatcaggga
aaacaggccaatctgtga

DBGET integrated database retrieval system