KEGG   Homo sapiens (human): 11178
Entry
11178             CDS       T01001                                 

Gene name
LZTS1, F37, FEZ1
Definition
(RefSeq) leucine zipper tumor suppressor 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Fez1
Other DBs
NCBI-GeneID: 11178
NCBI-ProteinID: NP_066300
OMIM: 606551
HGNC: 13861
Ensembl: ENSG00000061337
Vega: OTTHUMG00000097027
Pharos: Q9Y250(Tbio)
UniProt: Q9Y250
Position
8p21.3
AA seq 596 aa
MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHGKSSSKMG
KSEDFFYIKVSQKARGSHHPDYTALSSGDLGGQAGVDFDPSTPPKLMPFSNQLEMGSEKG
AVRPTAFKPVLPRSGAILHSSPESASHQLHPAPPDKPKEQELKPGLCSGALSDSGRNSMS
SLPTHSTSSSYQLDPLVTPVGPTSRFGGSAHNITQGIVLQDSNMMSLKALSFSDGGSKLG
HSNKADKGPSCVRSPISTDECSIQELEQKLLEREGALQKLQRSFEEKELASSLAYEERPR
RCRDELEGPEPKGGNKLKQASQKSQRAQQVLHLQVLQLQQEKRQLRQELESLMKEQDLLE
TKLRSYEREKTSFGPALEETQWEVCQKSGEISLLKQQLKESQTEVNAKASEILGLKAQLK
DTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRA
QAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVI
QYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgggcagcgtcagtagcctcatctccggccacagcttccacagcaagcactgccgggct
tcgcagtacaagctgcgcaagtcctcccacctcaagaagctcaaccggtattccgacggg
ctgctgaggtttggcttctcccaggactccggtcacggcaagtccagctccaaaatgggc
aagagcgaagacttcttctacatcaaggtcagccagaaagcccggggctcccatcaccca
gattacacggcactgtccagcggggatttagggggccaggctggggtggactttgacccg
tccacaccccccaagctcatgcccttctccaatcagctagaaatgggctccgagaagggt
gcagtgaggcccacagccttcaagcctgtgctgccacggtcaggagccatcctgcactcc
tccccggagagtgccagccaccagctgcaccccgcccctccagacaagcccaaggagcag
gagctgaagcctggcctgtgctctggggcgctgtcagactccggccggaactccatgtcc
agcctgcccacacacagcaccagcagcagctaccagctggacccgctggtcacacccgtg
ggacccacaagccgttttgggggctccgcccacaacatcacccagggcatcgtcctccag
gacagcaacatgatgagcctgaaggctctgtccttctccgacggaggtagcaagctgggc
cactcgaacaaggcagacaagggcccctcgtgtgtccgctcccccatctccacggacgag
tgcagcatccaggagctggagcagaagctgttggagagggagggcgccctccagaagctg
cagcgcagctttgaggagaaggagcttgcctccagcctggcctacgaggagcggccgcgg
cgctgcagggacgagctggagggcccggagcccaaaggcggcaacaagctcaagcaggcc
tcgcagaagagccagcgcgcgcagcaggtcctgcacctgcaggtactgcagcttcagcag
gagaagcggcagctccggcaggagctcgagagcctcatgaaggagcaggacctgctggag
accaagctcaggtcctacgagagggagaagaccagcttcggccccgcgctggaggagacc
cagtgggaggtgtgccagaagtcaggcgagatctccctcctgaagcagcagctgaaggag
tcccagacggaggtgaacgccaaggctagcgagatcctgggtctcaaggcacagctgaag
gacacgcggggcaagctggagggcctggagctgaggacccaggacctggagggcgccctg
cgcaccaagggcctggagctggaggtctgtgagaatgagctgcagcgcaagaagaacgag
gcggagctgctgcgggagaaggtgaacctgctggagcaggagctgcaggagctgcgggcc
caggccgccctggcccgcgacatggggccgcccaccttccccgaggacgtccctgccctg
cagcgggagctggagcggctgcgggccgagctgcgggaggagcggcaaggccatgaccag
atgtcctcgggcttccagcatgagcggctcgtgtggaaggaggagaaggagaaggtgatt
cagtaccagaaacagctgcagcagagctacgtggccatgtaccagcggaaccagcgcctg
gagaaggccctgcagcagctggcacgtggggacagcgccggggagcccttggaggttgac
ctggaaggggctgacatcccctacgaggacatcatagccactgagatctga

DBGET integrated database retrieval system