KEGG   Homo sapiens (human): 11181
Entry
11181             CDS       T01001                                 
Symbol
TREH, TRE, TREA, TREHD
Name
(RefSeq) trehalase
  KO
K01194  alpha,alpha-trehalase [EC:3.2.1.28]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
Disease
H02090  Trehalase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    11181 (TREH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    11181 (TREH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     11181 (TREH)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  11181 (TREH)
SSDB
Motif
Pfam: Trehalase MGH1-like_GH Glyco_hydro_63
Other DBs
NCBI-GeneID: 11181
NCBI-ProteinID: NP_009111
OMIM: 275360
HGNC: 12266
Ensembl: ENSG00000118094
UniProt: O43280
Position
11:complement(118657316..118679650)
AA seq 583 aa
MPGRTWELCLLLLLGLGLGSQEALPPPCESEIYCHGELLNQVQMAKLYQDDKQFVDMPLS
IAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKIS
DAKLRAWAGQLHQLWKKLGKKMKPEVLSHPERFSLIYSEHPFIVPGGRFVEFYYWDSYWV
MEGLLLSEMAETVKGMLQNFLDLVKTYGHVPNGGRVYYLQRSQPPLLTLMMDCYLTHTND
TAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYVPYGGPRPESYSKDVELADTL
PEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLNAFLCQAEELM
SNFYSRLGNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTP
LWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLA
KAPLRRAQEVAFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPGGGGEYEVQEGFGWTN
GVVLMLLDRYGDRLTSGAKLAFLEPHCLAATLLPSLLLSLLPW
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgccagggaggacctgggagctgtgcctgctactgctgctggggctgggactggggtcc
caggaggccctacccccaccctgtgagagtgagatttactgccacggggagctcctaaac
caagttcaaatggccaagctctaccaggatgacaagcagtttgtggacatgccactgtct
atagctccagaacaagtcctgcagaccttcactgagctgtccagggaccacaatcacagc
atccccagggagcagctgcaggcgtttgtccacgaacacttccaggccaaggggcaggag
ctgcagccctggacccctgcagactggaaagacagcccccagttcctgcagaagatttca
gatgccaaactgcgtgcctgggcagggcagctgcatcagctctggaagaagctggggaag
aagatgaagccagaggttctcagccaccctgagcggttctctctcatctactcagaacat
cccttcattgtgcctggcggtcgctttgttgagttctactactgggactcctactgggtc
atggagggtctgctcctctcagagatggctgagacggtgaagggcatgctgcagaacttc
ttggacctggtgaaaacctatgggcatgtccccaatggtgggcgcgtgtactacctgcag
cggagccagcccccactcttgaccctcatgatggattgctacttgactcacaccaatgac
accgcctttctacaggaaaacattgaaacactagccttggaattggacttttggaccaag
aacaggactgtctctgtgagcttggagggaaagaactacctcctgaatcgctattatgtc
ccttatgggggacccaggcctgagtcctacagcaaagatgtggagttggctgacaccttg
ccagaaggagaccgggaggctctgtgggctgagctcaaggctggggctgagtctggctgg
gacttctcttcacgctggctcattggaggcccaaaccccaactcgcttagcggcatccga
acaagcaaactggtgcctgttgacctgaatgccttcctatgccaagcagaggagctgatg
agcaacttctattccaggctggggaacgactcccaggccacgaagtacagaatcctgcgg
tcgcagcgcttggccgccctgaacacagtcctgtgggatgagcagaccggagcctggttc
gattacgaccttgagaagaagaagaaaaaccgggagttttacccatccaacctcactcca
ctctgggccgggtgtttctctgaccctggcgtggcggacaaggctctgaaatacctggag
gacaaccggatcctgacttaccagtatgggatcccgacctctctccagaagacaggccag
cagtgggatttccccaatgcctgggcccccctgcaggacctggtcatcagaggcctggcc
aaggcacctttacgtcgggcccaggaagtggctttccagctggctcagaattggatccga
accaattttgatgtctactcgcagaagtcagccatgtatgagaagtatgacgtcagcaac
ggtggacagcccggtgggggaggagaatatgaagttcaggagggatttggctggacgaat
ggcgtggtcctgatgctgctggaccgctatggtgaccggctgacctcaggggccaagctg
gctttcctggagccccactgcctggcggccacccttctgcccagcctcctgctcagcctc
ctgccatggtga

DBGET integrated database retrieval system