KEGG   Homo sapiens (human): 11183Help
Entry
11183             CDS       T01001                                 

Gene name
MAP4K5, GCKR, KHS, KHS1, MAPKKKK5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 5
  KO
K08833  mitogen-activated protein kinase kinase kinase kinase 5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11183 (MAP4K5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   11183 (MAP4K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 11183
NCBI-ProteinID: NP_006566
OMIM: 604923
HGNC: 6867
Ensembl: ENSG00000012983
Vega: OTTHUMG00000170888
Pharos: Q9Y4K4(Tchem)
UniProt: Q9Y4K4 B3KWC4
Position
14q22.1
AA seq 846 aa AA seqDB search
MEAPLRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFS
LIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYV
CRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPY
WMAPEVAAVEKNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKL
KDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVAQPGLSRALAVELLDKVNNPDNH
AHYTEADDDDFEPHAIIRHTIRSTNRNARAERTASEINFDKLQFEPPLRKETEARDEMGL
SSDPNFMLQWNPFVDGANTGKSTSKRAIPPPLPPKPRISSYPEDNFPDEEKASTIKHCPD
SESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKKDKRDFPK
PAINGLPPTPKVLMGACFSKVFDGCPLKINCATSWIHPDTKDQYIIFGTEDGIYTLNLNE
LHEATMEQLFPRKCTWLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHR
FPDRILPRKFALTTKIPDTKGCHKCCIVRNPYTGHKYLCGALQSGIVLLQWYEPMQKFML
IKHFDFPLPSPLNVFEMLVIPEQEYPMVCVAISKGTESNQVVQFETINLNSASSWFTEIG
AGSQQLDSIHVTQLERDTVLVCLDKFVKIVNLQGKLKSSKKLASELSFDFRIESVVCLQD
SVLAFWKHGMQGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA
GHENSY
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggaggccccgctgcggcctgccgcggacatcctgaggcggaacccgcagcaggactac
gaactcgtccagagggtcggcagcggcacctacggggacgtctataaggccagaaatgta
cacacaggagagctggctgcagtaaaaatcattaaattggagcctggagatgatttttct
ttgattcaacaagaaatatttatggttaaagaatgtaaacattgtaacatcgttgcctac
tttgggagttatcttagtcgggaaaaactatggatttgtatggaatactgtggtggcgga
tcacttcaagatatttaccatgttactggaccattatcagaattgcaaatagcctatgta
tgcagagaaaccttacagggtcttgcctatttgcatactaaaggcaaaatgcatagagat
atcaaaggtgctaatattttattgacagaccatggcgatgtaaaattagctgactttggt
gtggctgcaaaaataacagctaccattgcaaaacgaaaatctttcattggcaccccttac
tggatggccccagaagttgcagcagtagagaagaatggtggctacaaccaactctgtgat
atctgggcagtaggaataacagcaattgaacttggagaacttcagccacctatgtttgat
ctccacccaatgagggctctcttcttaatgtcaaaaagtaattttcagcctccaaaacta
aaggacaaaacaaaatggtcatcaacattccataattttgtcaaaatagcactaaccaaa
aacccaaaaaaaagaccaactgctgaaagacttctgactcacacttttgttgcacagcca
ggtctctctagagccctagcagttgaactgttagacaaagtgaacaatccagataaccac
gcacattacactgaagcagatgacgatgactttgagccccatgcaatcattcgtcatacc
attagatctacaaacaggaatgccagagctgaacggacagcttcagaaataaattttgac
aaattacaatttgaacctcctctgagaaaagaaacagaagcacgagatgaaatgggattg
tcatcagacccaaatttcatgttacagtggaatccttttgttgatggtgcaaatactggc
aaatcaacctcaaaacgtgcaataccacctcccctacctcctaagccaaggataagcagt
taccctgaagacaactttccggatgaagaaaaagcatcaaccataaaacattgtcctgat
tcagaaagcagagctccccaaattctcagaagacagagtagcccaagttgtgggcctgtg
gcagagacttcttctattggaaatggtgatggtatttcaaaactgatgagtgaaaataca
gaaggatcagcacaagcaccacagttaccacgaaaaaaggacaaacgagacttccctaaa
ccagccatcaatggccttccacccaccccaaaagttctgatgggagcatgcttttcaaaa
gtttttgatggctgtcctttgaaaattaattgtgcaacatcctggatacatcctgataca
aaagatcagtacattatttttggaactgaagatggtatttacacactgaatctcaatgag
ctacatgaggcaacgatggaacagttatttccacggaagtgtacttggctgtatgttatc
aataatactttaatgtcattatcagaaggaaaaacctttcagctctactctcacaatctt
atagctttgtttgaacatgccaaaaaaccaggattagctgcccatattcaaactcacagg
tttccagaccgaatactaccaagaaaattcgctttaacaacaaagattcctgatacaaaa
ggctgccacaaatgttgcatagtcagaaacccttacacgggacataaatacctctgtgga
gctttacagtctggaattgttttacttcagtggtatgagccaatgcagaaattcatgttg
ataaagcactttgattttcctttgccaagtcctttgaatgtttttgaaatgctggtgata
cctgaacaggaataccctatggtctgtgtagctattagcaaaggcactgaatcgaatcag
gtagttcagtttgagacaatcaatttgaactctgcatcttcatggtttacagaaattggt
gcaggcagccagcagttagattccattcatgtaacacagttggagagagataccgtttta
gtgtgtttagacaaatttgtgaaaattgtaaatctacaaggaaaattaaaatcaagtaag
aaactggcctctgagttaagttttgattttcgcattgaatctgtagtatgccttcaagac
agtgtgttggctttctggaaacatgggatgcagggtaaaagcttcaagtcagatgaggtt
acccaggagatttcagatgaaacaagagttttccgcttattaggatcagacagggttgtc
gttttggaaagtaggccaacagaaaatcctactgcacacagcaatctctacatcttggct
ggacatgaaaatagttactaa

DBGET integrated database retrieval system