KEGG   Homo sapiens (human): 11185Help
Entry
11185             CDS       T01001                                 

Gene name
INMT, TEMT
Definition
(RefSeq) indolethylamine N-methyltransferase
  KO
K00562  methyltransferase [EC:2.1.1.49 2.1.1.96]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa00450  Selenocompound metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    11185 (INMT)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    11185 (INMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.49  amine N-methyltransferase
     11185 (INMT)
    2.1.1.96  thioether S-methyltransferase
     11185 (INMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NNMT_PNMT_TEMT Methyltransf_23 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 11185
NCBI-ProteinID: NP_006765
OMIM: 604854
HGNC: 6069
Ensembl: ENSG00000241644
Vega: OTTHUMG00000167163
Pharos: O95050(Tchem)
UniProt: O95050
Structure
PDB: 

Position
7p14.3
AA seq 263 aa AA seqDB search
MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLI
DIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGN
SGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAAL
CNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQ
SYSVTNAANNGVCFIVARKKPGP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtggcttcactgggggtgatgagtaccagaagcacttcctgcccagggactac
ttggctacttactacagcttcgatggcagcccctcacccgaggccgagatgctgaagttt
aacttggaatgtctccacaagaccttcggccctggaggcctccaaggggacacgctgatt
gacattggctcaggtcctaccatctaccaagttcttgctgcctgtgattccttccaagac
atcactctctccgactttaccgaccgcaaccgggaggagctggaaaagtggctgaagaag
gagccgggggcctatgactggaccccagcggtgaaattcgcctgtgagctggaaggaaac
agcggccgatgggaggagaaggaggagaagctgcgggcagcggtgaagcgggtgctcaag
tgcgatgtccacctgggcaacccgctggccccggctgtgttgcctctcgccgactgtgtg
ctcaccctgctggccatggagtgtgcctgctgtagccttgatgcctaccgcgctgccctg
tgcaaccttgcctcactgctcaagccgggtggccacctggtgaccactgtcacgcttcgg
ctcccgtcctacatggtggggaagcgtgaattttcctgcgtggccctggagaaagaggag
gtggagcaggctgtcctggatgctggctttgacattgaacagctcctacacagtccccag
agctactctgtcaccaatgctgccaacaatggggtctgcttcattgtggctcgcaagaag
cctgggccctga

DBGET integrated database retrieval system