KEGG   Homo sapiens (human): 11186Help
Entry
11186             CDS       T01001                                 

Gene name
RASSF1, 123F2, NORE2A, RASSF1A, RDA32, REH3P21
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05219  Bladder cancer
hsa05223  Non-small cell lung cancer
Network
nt06213  Other RAS signaling
nt06266  Non-small cell lung cancer
  Element
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00097  Loss of RASSF1 to RAS-RASSF1 signaling pathway
Disease
H00014  Non-small cell lung cancer
H00022  Bladder cancer
H00054  Nasopharyngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11186 (RASSF1)
   04390 Hippo signaling pathway
    11186 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    11186 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11186 (RASSF1)
   05206 MicroRNAs in cancer
    11186 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    11186 (RASSF1)
   05223 Non-small cell lung cancer
    11186 (RASSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Motif
Other DBs
NCBI-GeneID: 11186
NCBI-ProteinID: NP_733832
OMIM: 605082
HGNC: 9882
Ensembl: ENSG00000068028
Vega: OTTHUMG00000149958
Pharos: Q9NS23(Tbio)
UniProt: Q9NS23
Position
3p21.31
AA seq 344 aa AA seqDB search
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggagcctgagctcattgagctgcgggagctggcacccgctgggcgcgctggg
aagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggcaccgcgtgc
aaccccacacggcagctggtccctggccgtggccaccgcttccagcccgcggggcccgcc
acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaaaggcctg
cagtgcgcgcgcctctctgcagattgcaagttcacctgccactaccgctgccgcgcgctc
gtctgcctggactgttgcgggccccgggacctgggctgggaacccgcggtggagcgggac
acgaacgtggacgagcctgtggagtgggagacacctgacctttctcaagctgagattgag
cagaagatcaaggagtacaatgcccagatcaacagcaacctcttcatgagcttgaacaag
gacggttcttacacaggcttcatcaaggttcagctgaagctggtgcgccctgtctctgtg
ccctccagcaagaagccaccctccttgcaggatgcccggcggggcccaggacggggcaca
agtgtcaggcgccgcacttccttttacctgcccaaggatgctgtcaagcacctgcatgtg
ctgtcacgcacaagggcacgtgaagtcattgaggccctgctgcgaaagttcttggtggtg
gatgacccccgcaagtttgcactctttgagcgcgctgagcgtcacggccaagtgtacttg
cggaagctgttggatgatgagcagcccctgcggctgcggctcctggcagggcccagtgac
aaggccctgagctttgtcctgaaggaaaatgactctggggaggtgaactgggacgccttc
agcatgcctgaactacataacttcctacgtatcctgcagcgggaggaggaggagcacctc
cgccagatcctgcagaagtactcctattgccgccagaagatccaagaggccctgcacgcc
tgcccccttgggtga

DBGET integrated database retrieval system