KEGG   Homo sapiens (human): 11190
Entry
11190             CDS       T01001                                 

Gene name
CEP250, C-NAP1, CEP2, CNAP1, CRDHL2
Definition
(RefSeq) centrosomal protein 250
  KO
K16464  centrosomal protein CEP250
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    11190 (CEP250)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    11190 (CEP250)
SSDB
Motif
Pfam: Rootletin
Other DBs
NCBI-GeneID: 11190
NCBI-ProteinID: NP_009117
OMIM: 609689
HGNC: 1859
Ensembl: ENSG00000126001
Vega: OTTHUMG00000032343
Pharos: Q9BV73(Tbio)
UniProt: Q9BV73
Position
20q11.22
AA seq 2442 aa
METRSPGLNNMKPQSLQLVLEEQVLALQQQMAENQAASWRKLKNSQEAQQRQATLVRKLQ
AKVLQYRSWCQELEKRLEATGGPIPQRWENVEEPNLDELLVRLEEEQQRCESLAEVNTQL
RLHMEKADVVNKALREDVEKLTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSL
WREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG
REPAQLLLLLAKTQELEKEAHERSQELIQLKSQGDLEKAELQDRVTELSALLTQSQKQNE
DYEKMIKALRETVEILETNHTELMEHEASLSRNAQEEKLSLQQVIKDITQVMVEEGDNIA
QGSGHENSLELDSSIFSQFDYQDADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQ
QQHDQWEEEGKALRQRLQKLTGERDTLAGQTVDLQGEVDSLSKERELLQKAREELRQQLE
VLEQEAWRLRRVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLS
ELITLREALESSHLEGELLRQEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVK
LSALNEALALDKVGLNQQLLQLEEENQSVCSRMEAAEQARNALQVDLAEAEKRREALWEK
NTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESRHQQEAATTQLEQLHQEAKRQ
EEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLESSLFEAQQQN
SVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEG
KTALEQQKAAHEKEVNQLREKWEKERSWHQQELAKALESLEREKMELEMRLKEQQTEMEA
IQAQREEERTQAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKL
KEQETTGILQTQLQEAQRELKEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLV
AQDDSQRLVEQEVQEKLRETQEYNRIQKELEREKASLTLSLMEKEQRLLVLQEADSIRQQ
ELSALRQDMQEAQGEQKELSAQMELLRQEVKEKEADFLAQEAQLLEELEASHITEQQLRA
SLWAQEAKAAQLQLRLRSTESQLEALAAEQQPGNQAQAQAQLASLYSALQQALGSVCESR
PELSGGGDSAPSVWGLEPDQNGARSLFKRGPLLTALSAEAVASALHKLHQDLWKTQQTRD
VLRDQVQKLEERLTDTEAEKSQVHTELQDLQRQLSQNQEEKSKWEGKQNSLESELMELHE
TMASLQSRLRRAELQRMEAQGERELLQAAKENLTAQVEHLQAAVVEARAQASAAGILEED
LRTARSALKLKNEEVESERERAQALQEQGELKVAQGKALQENLALLTQTLAEREEEVETL
RGQIQELEKQREMQKAALELLSLDLKKRNQEVDLQQEQIQELEKCRSVLEHLPMAVQERE
QKLTVQREQIRELEKDRETQRNVLEHQLLELEKKDQMIESQRGQVQDLKKQLVTLECLAL
ELEENHHKMECQQKLIKELEGQRETQRVALTHLTLDLEERSQELQAQSSQIHDLESHSTV
LARELQERDQEVKSQREQIEELQRQKEHLTQDLERRDQELMLQKERIQVLEDQRTRQTKI
LEEDLEQIKLSLRERGRELTTQRQLMQERAEEGKGPSKAQRGSLEHMKLILRDKEKEVEC
QQEHIHELQELKDQLEQQLQGLHRKVGETSLLLSQREQEIVVLQQQLQEAREQGELKEQS
LQSQLDEAQRALAQRDQELEALQQEQQQAQGQEERVKEKADALQGALEQAHMTLKERHGE
LQDHKEQARRLEEELAVEGRRVQALEEVLGDLRAESREQEKALLALQQQCAEQAQEHEVE
TRALQDSWLQAQAVLKERDQELEALRAESQSSRHQEEAARARAEALQEALGKAHAALQGK
EQHLLEQAELSRSLEASTATLQASLDACQAHSRQLEEALRIQEGEIQDQDLRYQEDVQQL
QQALAQRDEELRHQQEREQLLEKSLAQRVQENMIQEKQNLGQEREEEEIRGLHQSVRELQ
LTLAQKEQEILELRETQQRNNLEALPHSHKTSPMEEQSLKLDSLEPRLQRELERLQAALR
QTEAREIEWREKAQDLALSLAQTKASVSSLQEVAMFLQASVLERDSEQQRLQDELELTRR
ALEKERLHSPGATSTAELGSRGEQGVQLGEVSGVEAEPSPDGMEKQSWRQRLEHLQQAVA
RLEIDRSRLQRHNVQLRSTLEQVERERRKLKREAMRAAQAGSLEISKATASSPTQQDGRG
QKNSDAKCVAELQKEVVLLQAQLTLERKQKQDYITRSAQTSRELAGLHHSLSHSLLAVAQ
APEATVLEAETRRLDESLTQSLTSPGPVLLHPSPSTTQAASR
NT seq 7329 nt   +upstreamnt  +downstreamnt
atggagacaagaagccctgggttgaacaacatgaagccccagtcactgcagctggtactg
gaagagcaggtgctggcactacagcagcagatggcagagaatcaggcagcctcctggcgg
aagctgaagaactcccaggaggcccagcagagacaagcaacccttgtgaggaagctgcag
gccaaggtgctgcagtaccgaagctggtgccaagagctggagaagcggctagaagccact
ggaggaccaatcccccagaggtgggaaaatgtggaggagccaaacctggatgagctgctg
gtccgattggaggaggagcaacagaggtgtgagagtctagcagaggtgaacacccagctt
cgactgcacatggaaaaagctgacgtggtgaataaagcccttagggaagatgtggaaaaa
ctgacagtggactggagccgggcccgggatgagctaatgaggaaggagagccagtggcag
atggagcaggagttcttcaagggctacctgaaaggggagcacggtcgccttctcagtcta
tggcgggaggttgtgacattccgacgccacttcctggaaatgaagtcagctactgacaga
gatctgatggagctaaaagctgagcatgtgaggctttcagggtctctgttgacctgttgt
ctgcgcttgactgtgggagcacagtctcgggaacccaacggatctggaagaatggatggg
cgggagccggcccagctgctgctgctactagccaagacccaggagctggagaaggaagcc
catgaaaggagccaggagttaatacagctgaagagtcaaggggatctggagaaggctgaa
cttcaggaccgggtgaccgagctctctgctctgttgacccagtctcagaagcaaaatgaa
gattatgaaaagatgataaaggctctgagagagacagtggagatcctggagacaaatcac
acagaattaatggaacatgaagcatctcttagtaggaatgcgcaagaggagaagttgtct
ttacagcaggtgatcaaggatataacccaggtcatggtggaagaaggggacaatatagcc
caaggctctggtcatgagaactctttggaattggactctagtatcttctcccagtttgat
taccaggatgcagacaaggctcttactctggtgcgttcagtgctgactcggagacgccag
gctgtgcaggacctaaggcagcagcttgcaggctgtcaagaggctgtgaacttgttgcaa
cagcagcatgatcagtgggaggaagagggcaaagccttgagacagcggctgcagaagctc
actggggagcgggacactctggcagggcagactgtggacctccagggagaggtggactct
ctcagcaaggagcgagagctgctgcagaaggccagggaagagctgcggcagcagctggag
gtgctagagcaggaggcatggcgcctgcgaagggtaaatgtggagcttcagctgcagggg
gactctgcccagggccagaaggaggaacagcaggaggagctgcacctggctgtccgggag
agggagcgtcttcaggagatgctgatgggcctggaagccaaacagtcagaatcactcagt
gaactgatcactcttcgggaagccctggagtcaagtcacctggaaggggagttactgagg
caagagcaaacggaagtgaccgcagcgctggctagggcagagcagtcaattgcagagctg
tcgagttctgaaaacaccctgaagacagaagtagctgatcttcgggctgcagctgtcaag
ctcagtgccttaaatgaggctttggcgttagataaagttgggctgaaccagcagcttctc
cagttagaggaggagaaccagtctgtgtgcagcagaatggaggccgcagagcaggcgaga
aatgctttgcaggtcgacctggcggaggcagagaagaggagggaagccctgtgggaaaag
aacactcacctggaggctcagctgcagaaagctgaggaggctggggctgagctgcaggca
gatctcagggacatccaagaagagaaggaagaaattcaaaagaaactaagtgagtcacgt
caccagcaggaggcagccacgactcagctggagcagctacatcaggaggcaaagcgacag
gaagaagtgcttgccagggcagtccaggagaaggaggccctagtacgagagaaagcggct
ctagaggtgcggctgcaggccgtggagcgtgaccggcaggacctcgctgaacaactacag
gggctcagctcagccaaggagctactggagagcagtctgtttgaagcccaacaacaaaat
tctgtgatagaggtcaccaaggggcagctggaggtccagattcaaactgtcactcaagcc
aaggaagtaatccaaggggaagtgaggtgcctgaagctggaactggacactgaacggagt
caggcagagcaggagcgggatgctgcagccagacagctggcccaggctgagcaagaaggg
aagactgccttggagcagcagaaggcagcccatgagaaagaggtgaaccagctccgggag
aaatgggagaaggagcgctcctggcaccagcaggagctggcaaaggctctggagagctta
gaaagggaaaaaatggagctggaaatgaggctaaaggagcagcagacagaaatggaggcc
atccaggcccagagggaagaagaacggacccaggcagagagtgccctatgccagatgcag
ctggaaacagagaaggagagagtatccctcctggagacactgctgcagacgcagaaggag
ctagcagatgccagccaacaactggaacgactgaggcaggacatgaaagtccagaaatta
aaggagcaggagaccactgggatactacagacccagctccaggaggctcaacgggagctg
aaggaggcagcccggcagcacagagatgaccttgctgccctccaagaagagagcagctcc
ctgctgcaggataagatggacctgcagaagcaggtggaggacttgaagtctcagctggtg
gcccaggatgactcccagaggctggtggagcaggaggttcaggagaagctgagagagacc
caggagtataaccgaattcagaaggagctggagagagagaaagccagcctgactctctca
ctgatggaaaaggaacagagactccttgttttacaagaagctgactctattcgacaacaa
gagctgagtgccctgcgccaggacatgcaggaggcccagggagaacagaaagagctcagt
gctcagatggaattactaaggcaagaggtgaaggaaaaggaggctgactttctggcccag
gaagcacagctgctggaggagctggaggcgtctcatatcacggagcagcagctgcgagcc
tccttgtgggcccaggaagccaaggcagcccaactacagctgcgactgcgcagcacagag
agccagctagaagcgctggccgcagagcagcagcccgggaaccaggcccaggcccaggcc
cagctggccagcctctactctgccctgcagcaggccctggggtctgtttgtgagagcagg
cctgagctgagtggtgggggagactctgctccttccgtctggggccttgagccagaccag
aatggagctaggagcctctttaagagagggcccctgctgactgctctctccgctgaggca
gtagcatctgccctccacaagcttcatcaagacctgtggaagactcaacagacccgggat
gttctgagggatcaggtccagaaactggaagagcgtctaactgatactgaggctgagaag
agccaggtccacacagagttgcaggatctgcagagacagctctcccagaatcaggaagag
aaatctaagtgggaaggaaagcagaactccctagaatctgagctgatggaactacatgaa
actatggcatccttacagagtcgcctgcggagagcagagctacagcgaatggaagcccag
ggtgagcgagagttacttcaggcagccaaggagaacctgacagcccaggtggaacacctg
caagcagctgtcgtagaagccagggctcaggcaagtgctgctggcatcctggaagaagac
ctgagaacggctcgctcagcactgaagctgaaaaatgaggaagtagagagtgagcgtgag
agagcccaggctctgcaagagcagggcgaactgaaggtggcccaagggaaggctctgcaa
gagaatttggccctcctgacccagaccctagctgaaagagaagaggaggtggagactctg
cggggacaaatccaggaactggagaagcaacgggaaatgcagaaggctgctttggaattg
ctgtctctggacctgaagaagaggaaccaagaggtagatctgcagcaagaacagattcag
gagctagagaagtgtaggtctgttttagagcatctgcccatggccgtccaggagcgagag
cagaagctgactgtgcagagggagcagatcagagagctcgagaaggatcgggagactcag
aggaacgtcttggagcatcagcttctagaacttgagaagaaagaccaaatgattgagtcc
cagagaggacaggttcaggacctgaaaaagcagttggttactctggaatgcctggccctg
gaactggaggaaaaccatcacaagatggagtgccagcaaaaactgatcaaggagctggag
ggccagagggaaacccagagagtggctttgacccaccttacgctggacctagaagaaagg
agccaggagctgcaggcacaaagcagccagatccatgacctggagagccacagcaccgtt
ctggcaagagagctgcaggagagggaccaggaggtgaagtctcagcgagaacagatcgag
gagctgcagaggcagaaagagcatctgactcaggatctcgagaggagagaccaggagctg
atgctgcagaaggagaggattcaggttctcgaggatcagaggacccggcagaccaagatc
ctggaggaggacctggaacagatcaagctgtccttgagagagcgaggccgggagctgacc
actcagaggcagctgatgcaggaacgggcagaggaagggaagggcccaagtaaagcacag
cgcgggagcctagagcacatgaagctgatcctgcgtgataaggagaaggaggtggaatgt
cagcaggagcatatccatgaactccaggagctcaaagaccagctggagcagcagctccag
ggcctgcacaggaaggtaggtgagaccagcctcctcctgtcccagcgagagcaggaaata
gtggtcctgcagcagcaactgcaggaagccagggaacaaggggagctgaaggagcagtca
cttcagagtcaactggatgaggcccagagagccctagcccagagggaccaggaactggag
gctctgcagcaagaacagcagcaggcccagggacaggaggagagggtgaaggaaaaggca
gacgccctccagggagctctggagcaagcccatatgacactgaaggagcgtcatggagag
cttcaggaccacaaggaacaggcacgaaggctggaggaagagctggcagtggagggacgg
cgggtccaggccctggaggaggtgctgggagacctaagggctgagtctcgggaacaggag
aaagctctgttggccctccagcagcagtgtgctgagcaggcacaggagcatgaggtggag
accagggccctgcaggacagctggctgcaggcccaggcagtgctcaaggaacgggaccag
gagctggaagctctgcgggcagaaagtcagtcctcccggcatcaggaggaggctgcccgg
gcccgggctgaggctctgcaggaggcccttggcaaggctcatgctgccctgcaggggaaa
gagcagcatctcctcgagcaggcagaattgagccgcagtctggaggccagcactgcaacc
ctgcaagcctccctggatgcctgccaggcacacagtcggcagctggaggaggctctgagg
atacaagaaggtgagatccaggaccaggatctccgataccaggaggatgtgcagcagctg
cagcaggcacttgcccagagggatgaagagctgagacatcagcaggaacgggagcagctg
ctggagaagtctctggcccagagggtccaagagaatatgatccaagagaagcagaatctg
gggcaagagagagaagaggaggagataaggggccttcatcagagtgtaagggagctacag
ctgactctagcccaaaaggaacaggagattctggagctgagggagacccagcaaaggaac
aacctggaagccttaccccacagccacaaaacctccccaatggaggaacaatctctaaaa
cttgattctttagagcccaggctgcagcgggagctggagcggctacaggcagccctgaga
cagacagaagccagggagattgagtggagggagaaggcccaggacttggcactctcccta
gcgcagaccaaggccagtgtcagcagtctgcaggaggtagccatgttcctacaagcctct
gtcctggagcgggactcagaacagcaaaggctgcaggatgaactggagctcaccagacgg
gctctggagaaggagcggctacacagcccaggtgcaaccagcacagcagaactggggtcc
agaggggagcagggtgtgcagctgggagaggtctcaggagtggaggctgagcctagtcct
gatggaatggagaagcagtcatggagacaaaggcttgaacacctgcagcaagcagtggcc
cggctggagattgacaggagcaggctgcagcgccacaatgtccagctgcggagtaccttg
gagcaggtggagcgagaacggaggaagctgaagagggaggccatgcgtgcggcccaggca
gggtccctagagatcagcaaggccacggcttcttcacccacacagcaggatgggagagga
cagaagaactcagatgccaagtgtgtggctgaactgcagaaagaggtggtcctgctgcaa
gctcagctgactttggagcggaagcagaagcaggactacatcacccgctcagcacagacc
agccgtgagctagcaggcctgcaccacagcctctcacactcacttcttgccgtggcccag
gcccctgaggccactgtcctggaggcagagacccgcaggctggatgagtccctgactcaa
agtctgacatccccagggccagtcctgctacaccccagccccagcactacccaagccgcc
tccaggtag

DBGET integrated database retrieval system