KEGG   Homo sapiens (human): 11193
Entry
11193             CDS       T01001                                 

Gene name
WBP4, FBP21
Definition
(RefSeq) WW domain binding protein 4
  KO
K13220  WW domain-binding protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    11193 (WBP4)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    11193 (WBP4)
SSDB
Motif
Pfam: WW zf-U1
Other DBs
NCBI-GeneID: 11193
NCBI-ProteinID: NP_009118
OMIM: 604981
HGNC: 12739
Ensembl: ENSG00000120688
Vega: OTTHUMG00000016784
Pharos: O75554(Tbio)
UniProt: O75554
Structure
PDB: 
5O9Z 2JXW 2DK1

Position
13q14.11
AA seq 376 aa
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRK
KDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTY
YYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGV
STETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEI
KQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRR
TENGKSRNLRQRGDDQ
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcggactactggaagtcacagccaaagaaattctgtgattactgcaagtgctggata
gcagacaataggcctagtgttgaatttcatgaaagaggaaagaatcataaggaaaatgtg
gcaaaaaggatcagtgagattaaacagaaaagcctggataaggcaaaggaagaagaaaag
gcatcaaaggagtttgctgcaatggaggcagctgccctgaaagcataccaagaggatttg
aaaagacttggcttagagtcagaaattttggagccaagcataacaccagtaaccagcact
atcccacctacctcgacatcaaatcaacagaaagaaaagaaagaaaagaagaaaagaaaa
aaagatccttcaaagggcagatgggtagaaggcataacctctgagggttaccattactat
tatgatcttatctcaggagcatctcagtgggagaaacctgaaggatttcaaggagactta
aaaaagacagcagtgaagaccgtttgggtagaaggtttaagtgaagatggttttacctat
tactataatacagaaacaggagaatccagatgggagaaacctgatgatttcattccacac
actagtgatctgccttctagtaaggtcaatgaaaattcacttggcaccctagatgaatcc
aaatcatcagattcgcatagtgattctgatggggaacaggaagcagaagaaggaggggtc
tctacagagacagaaaagccaaaaataaagtttaaggaaaaaaataaaaatagtgatgga
ggaagtgacccagaaacacagaaagaaaaaagtattcagaaacagaattcattaggttca
aatgaagaaaaatcgaaaactcttaagaaatcaaacccatatggagaatggcaagaaatt
aaacaagaggttgagtctcatgaggaggtagatttggaacttccaagcactgaaaatgag
tatgtatcaacttcagaagctgatggtggcggagaacccaaagtggtatttaaagaaaaa
acagtcacttctcttggagttatggcagatggagtggccccagtcttcaaaaagagaaga
actgaaaatggaaaatctagaaatttaaggcaacgaggtgatgatcaatag

DBGET integrated database retrieval system