KEGG   Homo sapiens (human): 11194Help
Entry
11194             CDS       T01001                                 

Gene name
ABCB8, EST328128, M-ABC1, MABC1
Definition
(RefSeq) ATP binding cassette subfamily B member 8
  KO
K05655  ATP-binding cassette, subfamily B (MDR/TAP), member 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    11194 (ABCB8)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    11194 (ABCB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N Zeta_toxin AAA_16 AAA_22 ABC_membrane_2 AAA_30 DUF87 AAA_25 APS_kinase SbcCD_C AAA ABC_ATPase
Motif
Other DBs
NCBI-GeneID: 11194
NCBI-ProteinID: NP_001269220
OMIM: 605464
HGNC: 49
Ensembl: ENSG00000197150
Vega: OTTHUMG00000158686
Pharos: Q9NUT2(Tbio)
UniProt: Q9NUT2
Position
7q36.1
AA seq 735 aa AA seqDB search
MLVHLFRVGIRGGPFPGRLLPPLRFQTFSAVRNTWRNGKTGQLHKAEGEYSDGYRSSSLL
RAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPP
ASSTPHVVGSRFNWKLFWQFLHPHLLVLGVAVVLALGAALVNVQIPLLLGQLVEVVAKYT
RDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDI
TFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMV
ATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAE
LEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQT
VQRSMANLSVLFGQVVRGLSAGARVFEYMALNPCIPLSGGCCVPKEQLRGSVTFQNVCFS
YPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRT
LDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEG
YNTVVGERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAG
RTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALDAPRTAAP
PPKKPEGPRSHQHKS
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgcatttatttcgggtcgggattcggggtggcccattcccaggcaggctgcta
ccgcccctccgcttccagacattctcagctgtcagaaacacatggcgtaatgggaaaact
ggacagttacacaaggcagaaggagagtactctgatggctaccgcagctcctccctcctc
cgggccgtggcccacctgcggtcccagctctgggcccacctccctcgagcccccctagct
cccagatggagcccctctgcctggtgctgggttgggggagccctgctaggccccatggta
ctgagtaagcatccccacctctgccttgtggccctgtgtgaggcagaagaggcccctcct
gccagctccacaccccatgtcgtggggtctcgctttaactggaagctcttctggcagttt
ctgcacccccacctgctggtcctgggggtagccgtcgtgctggccttgggtgcggcactc
gtgaatgtacagatccccctgctcctgggccagctggtagaggtcgtggccaagtacaca
agggaccacgtagggagtttcatgactgagtcccagaatctcagcacccacctgcttatc
ctctatggtgtccagggactgctgaccttcgggtacctggtgctgctgtcccacgttggc
gagcgcatggctgtggacatgcggagggccctcttcagctccctgctccgacaagacatc
accttctttgacgccaataagacagggcagctggtgagccgcttgacaactgacgtgcag
gagtttaagtcatccttcaagcttgtcatctcccaggggctgcgaagctgcacccaggtg
gcaggctgcctggtgtccctgtccatgctgtcgacacgcctcacgctgctgctgatggtg
gccacaccagccctgatgggagtgggcaccctgatgggctcaggcctccgaaaattgtct
cgccagtgtcaggagcagatcgccagggcaatgggcgtagcagacgaggccctgggcaat
gtgcggactgtgcgtgccttcgccatggagcaacgggaagaggagcgctatggggcagag
ctggaagcctgccgctgccgggcagaggagctgggccgcggcatcgccttgttccaaggg
ctttccaacatcgccttcaactgcatggtcttgggtaccctatttattgggggctccctt
gtggccggacagcagctgacagggggagacctcatgtccttcctggtggcctcccagaca
gtgcaaaggtccatggccaacctctctgtcctgtttgggcaggtggtccgggggctgagt
gcaggtgcccgggtctttgagtacatggccctgaacccctgcatcccactgtctgggggc
tgctgcgtccccaaagagcagctgcgtggctccgttacatttcagaacgtctgcttcagc
tacccctgccgccccggcttcgaggtgctgaaagacttcaccctgacgctgccccctggc
aagatcgtggccctcgtgggccagtctggcggaggaaagaccaccgtggcttccctgctg
gagcgcttctacgaccccacggcaggcgtggtgatgctggatgggcgggacctgcgcacc
cttgacccctcctggctccggggccaggttgtcggcttcatcagccaggagcccgtcctg
tttgggacgaccatcatggaaaacatccgctttgggaagctggaagcttccgatgaagag
gtgtacacagccgcccgggaagcgaatgctcacgagttcatcaccagcttccccgagggc
tacaacacggtcgtcggtgaacggggcactaccctgtctgggggccagaagcagcgcctg
gccatcgcccgagcccttatcaagcagcccacggtgctgatactggatgaagctaccagc
gcgctggatgcagagtccgagcgggttgtacaggaggccctggaccgggccagtgcaggc
cgcacggtgctggtaattgcccaccggctcagcactgtccgtggggcccactgcattgtc
gtcatggccgatggccgtgtctgggaggctgggacacatgaagagctcctgaagaaaggc
gggctatacgccgagctcatccggaggcaggccctggatgccccgaggacagcggcccca
ccgcccaaaaagccagaaggccccaggagccaccagcacaagtcctga

DBGET integrated database retrieval system