KEGG   Homo sapiens (human): 1120Help
Entry
1120              CDS       T01001                                 

Gene name
CHKB, CHETK, CHKL, CK, CKB, CKEKB, EK, EKB, MDCMC
Definition
(RefSeq) choline kinase beta
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa05231  Choline metabolism in cancer
Module
hsa_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
hsa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    1120 (CHKB)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    1120 (CHKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     1120 (CHKB)
    2.7.1.82  ethanolamine kinase
     1120 (CHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 1120
NCBI-ProteinID: NP_005189
OMIM: 612395
HGNC: 1938
Ensembl: ENSG00000100288
Vega: OTTHUMG00000150275
Pharos: Q9Y259(Tbio)
UniProt: Q9Y259 A0A024R4X4
Structure
PDB: 

Position
22q13.33
AA seq 395 aa AA seqDB search
MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGA
WRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH
NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP
TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ
ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaggcgacagctgtggccggaagcggggctgttggcggctgcctggccaaa
gacggcttgcagcagtctaagtgcccggacactaccccaaaacggcggcgcgcctcgtcg
ctgtcgcgtgacgccgagcgccgagcctaccaatggtgccgggagtacttgggcggggcc
tggcgccgagtgcagcccgaggagctgagggtttaccccgtgagcggaggcctcagcaac
ctgctcttccgctgctcgctcccggaccacctgcccagcgttggcgaggagccccgggag
gtgcttctgcggctgtacggagccatcttgcagggcgtggactccctggtgctagaaagc
gtgatgttcgccatacttgcggagcggtcgctggggccccagctgtacggagtcttccca
gagggccggctggaacagtacatcccaagtcggccattgaaaactcaagagcttcgagag
ccagtgttgtcagcagccattgccacgaagatggcgcaatttcatggcatggagatgcct
ttcaccaaggagccccactggctgtttgggaccatggagcggtacctaaaacagatccag
gacctgcccccaactggcctccctgagatgaacctgctggagatgtacagcctgaaggat
gagatgggcaacctcaggaagttactagagtctaccccatcgccagtcgtcttctgccac
aatgacatccaggaagggaacatcttgctgctctcagagccagaaaatgctgacagcctc
atgctggtggacttcgagtacagcagttataactataggggctttgacattgggaaccat
ttttgtgagtgggtttatgattatactcacgaggaatggcctttctacaaagcaaggccc
acagactaccccactcaagaacagcagttgcattttattcgtcattacctggcagaggca
aagaaaggtgagaccctctcccaagaggagcagagaaaactggaagaagatttgctggta
gaagtcagtcggtatgctctggcatcccatttcttctggggtctgtggtccatcctccag
gcatccatgtccaccatagaatttggttacttggactatgcccagtctcggttccagttc
tacttccagcagaaggggcagctgaccagtgtccactcctcatcctga

DBGET integrated database retrieval system