KEGG   Homo sapiens (human): 11200Help
Entry
11200             CDS       T01001                                 

Gene name
CHEK2, CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53, hCds1
Definition
(RefSeq) checkpoint kinase 2
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00455  CDC25-Cell cycle G2/M
Disease
H00881  Li-Fraumeni syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    11200 (CHEK2)
   04115 p53 signaling pathway
    11200 (CHEK2)
   04218 Cellular senescence
    11200 (CHEK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11200 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    11200 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    11200 (CHEK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11200 (CHEK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   11200 (CHEK2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    11200 (CHEK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr FHA Kinase-like Pkinase_fungal Kdo Haspin_kinase RIO1 YrbL-PhoP_reg APH
Motif
Other DBs
NCBI-GeneID: 11200
NCBI-ProteinID: NP_009125
OMIM: 604373
HGNC: 16627
Ensembl: ENSG00000183765
Vega: OTTHUMG00000151023
Pharos: O96017(Tchem)
UniProt: O96017
Structure
PDB: 

Position
22q12.1
AA seq 543 aa AA seqDB search
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKS
CEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKR
RPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFER
KTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEE
DCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEA
LRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCA
AVL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgggagtcggatgttgaggctcagcagtctcatggcagcagtgcctgttcacag
ccccatggcagcgttacccagtcccaaggctcctcctcacagtcccagggcatatccagc
tcctctaccagcacgatgccaaactccagccagtcctctcactccagctctgggacactg
agctccttagagacagtgtccactcaggaactctattctattcctgaggaccaagaacct
gaggaccaagaacctgaggagcctacccctgccccctgggctcgattatgggcccttcag
gatggatttgccaatcttgaatgtgtgaatgacaactactggtttgggagggacaaaagc
tgtgaatattgctttgatgaaccactgctgaaaagaacagataaataccgaacatacagc
aagaaacactttcggattttcagggaagtgggtcctaaaaactcttacattgcatacata
gaagatcacagtggcaatggaacctttgtaaatacagagcttgtagggaaaggaaaacgc
cgtcctttgaataacaattctgaaattgcactgtcactaagcagaaataaagtttttgtc
ttttttgatctgactgtagatgatcagtcagtttatcctaaggcattaagagatgaatac
atcatgtcaaaaactcttggaagtggtgcctgtggagaggtaaagctggctttcgagagg
aaaacatgtaagaaagtagccataaagatcatcagcaaaaggaagtttgctattggttca
gcaagagaggcagacccagctctcaatgttgaaacagaaatagaaattttgaaaaagcta
aatcatccttgcatcatcaagattaaaaacttttttgatgcagaagattattatattgtt
ttggaattgatggaagggggagagctgtttgacaaagtggtggggaataaacgcctgaaa
gaagctacctgcaagctctatttttaccagatgctcttggctgtgcagtaccttcatgaa
aacggtattatacaccgtgacttaaagccagagaatgttttactgtcatctcaagaagag
gactgtcttataaagattactgattttgggcactccaagattttgggagagacctctctc
atgagaaccttatgtggaacccccacctacttggcgcctgaagttcttgtttctgttggg
actgctgggtataaccgtgctgtggactgctggagtttaggagttattctttttatctgc
cttagtgggtatccacctttctctgagcataggactcaagtgtcactgaaggatcagatc
accagtggaaaatacaacttcattcctgaagtctgggcagaagtctcagagaaagctctg
gaccttgtcaagaagttgttggtagtggatccaaaggcacgttttacgacagaagaagcc
ttaagacacccgtggcttcaggatgaagacatgaagagaaagtttcaagatcttctgtct
gaggaaaatgaatccacagctctaccccaggttctagcccagccttctactagtcgaaag
cggccccgtgaaggggaagccgagggtgccgagaccacaaagcgcccagctgtgtgtgct
gctgtgttgtga

DBGET integrated database retrieval system