KEGG   Homo sapiens (human): 11202
Entry
11202             CDS       T01001                                 

Gene name
KLK8, HNP, NP, NRPN, PRSS19, TADG14
Definition
(RefSeq) kallikrein related peptidase 8
  KO
K08650  kallikrein 8 [EC:3.4.21.118]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    11202 (KLK8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.118  kallikrein 8
     11202 (KLK8)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   11202 (KLK8)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 11202
NCBI-ProteinID: NP_009127
OMIM: 605644
HGNC: 6369
Ensembl: ENSG00000129455
Vega: OTTHUMG00000183086
Pharos: O60259(Tbio)
UniProt: O60259
Structure
PDB: 
5MS4 5MS3

Position
19q13.41
AA seq 260 aa
MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGG
VLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHD
LMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFP
QKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPG
VYTNICRYLDWIKKIIGSKG
NT seq 783 nt   +upstreamnt  +downstreamnt
atgggacgcccccgacctcgtgcggccaagacgtggatgttcctgctcttgctgggggga
gcctgggcaggacactccagggcacaggaggacaaggtgctggggggtcatgagtgccaa
ccccattcgcagccttggcaggcggccttgttccagggccagcaactactctgtggcggt
gtccttgtaggtggcaactgggtccttacagctgcccactgtaaaaaaccgaaatacaca
gtacgcctgggagaccacagcctacagaataaagatggcccagagcaagaaatacctgtg
gttcagtccatcccacacccctgctacaacagcagcgatgtggaggaccacaaccatgat
ctgatgcttcttcaactgcgtgaccaggcatccctggggtccaaagtgaagcccatcagc
ctggcagatcattgcacccagcctggccagaagtgcaccgtctcaggctggggcactgtc
accagtccccgagagaattttcctgacactctcaactgtgcagaagtaaaaatctttccc
cagaagaagtgtgaggatgcttacccggggcagatcacagatggcatggtctgtgcaggc
agcagcaaaggggctgacacgtgccagggcgattctggaggccccctggtgtgtgatggt
gcactccagggcatcacatcctggggctcagacccctgtgggaggtccgacaaacctggc
gtctataccaacatctgccgctacctggactggatcaagaagatcataggcagcaagggc
tga

DBGET integrated database retrieval system