KEGG   Homo sapiens (human): 1121Help
Entry
1121              CDS       T01001                                 

Gene name
CHM, DXS540, GGTA, HSD-32, REP-1, TCD
Definition
(RefSeq) CHM Rab escort protein
  KO
K23460  Rab proteins geranylgeranyltransferase component A
Organism
hsa  Homo sapiens (human)
Disease
H01116  Choroideremia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    1121 (CHM)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1121 (CHM)
Prenyltransferases [BR:hsa01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   1121 (CHM)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    1121 (CHM)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    1121 (CHM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDI NAD_binding_8 FAD_oxidored FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1121
NCBI-ProteinID: NP_000381
OMIM: 300390
HGNC: 1940
Ensembl: ENSG00000188419
Vega: OTTHUMG00000021937
Pharos: P24386(Tbio)
UniProt: P24386 A8K545
Position
Xq21.2
AA seq 653 aa AA seqDB search
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHALVTSANSTEAADSAFLPTEDESLSTMSCEMLTEQTPSSDPENALEVNGAEVTGEKEN
HCDDKTCVPSTSAEDMSENVPIAEDTTEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLTMVEKRMLMKFLT
FCMEYEKYPDEYKGYEEITFYEYLKTQKLTPNLQYIVMHSIAMTSETASSTIDGLKATKN
FLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAII
DQFGQRIISEHFLVEDSYFPENMCSRVQYRQISRAVLITDRSVLKTDSDQQISILTVPAE
EPGTFAVRVIELCSSTMTCMKGTYLVHLTCTSSKTAREDLESVVQKLFVPYTEMEIENEQ
VEKPRILWALYFNMRDSSDISRSCYNDLPSNVYVCSGPDCGLGNDNAVKQAETLFQEICP
NEDFCPPPPNPEDIILDGDSLQPEASESSAIPEANSETFKESTNLGNLEESSE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcggatactctcccttcggagtttgatgtgatcgtaatagggacgggtttgcctgaa
tccatcattgcagctgcatgttcaagaagtggccggagagttctgcatgttgattcaaga
agctactatggaggaaactgggccagttttagcttttcaggactattgtcctggctaaag
gaataccaggaaaacagtgacattgtaagtgacagtccagtgtggcaagaccagatcctt
gaaaatgaagaagccattgctcttagcaggaaggacaaaactattcaacatgtggaagta
ttttgttatgccagtcaggatttgcatgaagatgtcgaagaagctggtgcactgcagaaa
aatcatgctcttgtgacatctgcaaactccacagaagctgcagattctgccttcctgcct
acggaggatgagtcattaagcactatgagctgtgaaatgctcacagaacaaactccaagc
agcgatccagagaatgcgctagaagtaaatggtgctgaagtgacaggggaaaaagaaaac
cattgtgatgataaaacttgtgtgccatcaacttcagcagaagacatgagtgaaaatgtg
cctatagcagaagataccacagagcaaccaaagaaaaacagaattacttactcacaaatt
attaaagaaggcaggagatttaatattgatttagtatcaaagctgctgtattctcgagga
ttactaattgatcttctaatcaaatctaatgttagtcgatatgcagagtttaaaaatatt
accaggattcttgcatttcgagaaggacgagtggaacaggttccgtgttccagagcagat
gtctttaatagcaaacaacttactatggtagaaaagcgaatgctaatgaaatttcttaca
ttttgtatggaatatgagaaatatcctgatgaatataaaggatatgaagagatcacattt
tatgaatatttaaagactcaaaaattaacccccaacctccaatatattgtcatgcattca
attgcaatgacatcagagacagccagcagcaccatagatggtctcaaagctaccaaaaac
tttcttcactgtcttgggcggtatggcaacactccatttttgtttcctttatatggccaa
ggagaactcccccagtgtttctgcaggatgtgtgctgtgtttggtggaatttattgtctt
cgccattcagtacagtgccttgtagtggacaaagaatccagaaaatgtaaagcaattata
gatcagtttggtcagagaataatctctgagcatttcctcgtggaggacagttactttcct
gagaacatgtgctcacgtgtgcaatacaggcagatctccagggcagtgctgattacagat
agatctgtcctaaaaacagattcagatcaacagatttccattttgacagtgccagcagag
gaaccaggaacttttgctgttcgggtcattgagttatgttcttcaacgatgacatgcatg
aaaggcacctatttggttcatttgacttgcacatcttctaaaacagcaagagaagattta
gaatcagttgtgcagaaattgtttgttccatatactgaaatggagatagaaaatgaacaa
gtagaaaagccaagaattctgtgggctctttacttcaatatgagagattcgtcagacatc
agcaggagctgttataatgatttaccatccaacgtttatgtctgctctggcccagattgt
ggtttaggaaatgataatgcagtcaaacaggctgaaacacttttccaggaaatctgcccc
aatgaagatttctgtccccctccaccaaatcctgaagacattatccttgatggagacagt
ttacagccagaggcttcagaatccagtgccataccagaggctaactcggagactttcaag
gaaagcacaaaccttggaaacctagaggagtcctctgaataa

DBGET integrated database retrieval system