KEGG   Homo sapiens (human): 11211Help
Entry
11211             CDS       T01001                                 

Gene name
FZD10, CD350, FZ-10, Fz10, FzE7, hFz10
Definition
(RefSeq) frizzled class receptor 10
  KO
K02842  frizzled 9/10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    11211 (FZD10)
   04390 Hippo signaling pathway
    11211 (FZD10)
   04150 mTOR signaling pathway
    11211 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11211 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    11211 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11211 (FZD10)
   05205 Proteoglycans in cancer
    11211 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    11211 (FZD10)
   05226 Gastric cancer
    11211 (FZD10)
   05217 Basal cell carcinoma
    11211 (FZD10)
   05224 Breast cancer
    11211 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11211 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11211 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    11211 (FZD10)
   04090 CD molecules [BR:hsa04090]
    11211 (FZD10)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  11211 (FZD10)
CD molecules [BR:hsa04090]
 Proteins
  11211 (FZD10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 11211
NCBI-ProteinID: NP_009128
OMIM: 606147
HGNC: 4039
Ensembl: ENSG00000111432
Pharos: Q9ULW2(Tbio)
UniProt: Q9ULW2 Q6NSL8
Position
12q24.33
AA seq 581 aa AA seqDB search
MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEH
PLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcccgggcccccgcctgtggctggtcctgcaggtgatgggctcgtgcgccgcc
atcagctccatggacatggagcgcccgggcgacggcaaatgccagcccatcgagatcccg
atgtgcaaggacatcggctacaacatgactcgtatgcccaacctgatgggccacgagaac
cagcgcgaggcagccatccagttgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgccgatgtgcaccgagcaggtctct
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatt
atggagcagttcaacttcaagtggcccgactccctggactgccggaaactccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaacggctcggacgagcccacccgg
ggctcgggcctgttcccgccgctgttccggccgcagcggccccacagcgcgcaggagcac
ccgctgaaggacgggggccccgggcgcggcggctgcgacaacccgggcaagttccaccac
gtggagaagagcgcgtcgtgcgcgccgctctgcacgcccggcgtggacgtgtactggagc
cgcgaggacaagcgcttcgcagtggtctggctggccatctgggcggtgctgtgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccggcccgcttccgctaccccgag
cgccccatcatcttcctctccatgtgctactgcgtctactccgtgggctacctcatccgc
ctcttcgccggcgccgagagcatcgcctgcgaccgggacagcggccagctctatgtcatc
caggagggactggagagcaccggctgcacgctggtcttcctggtcctctactacttcggc
atggccagctcgctgtggtgggtggtcctcacgctcacctggttcctggccgccggcaag
aagtggggccacgaggccatcgaagccaacagcagctacttccacctggcagcctgggcc
atcccggcggtgaagaccatcctgatcctggtcatgcgcagggtggcgggggacgagctc
accggggtctgctacgtgggcagcatggacgtcaacgcgctcaccggcttcgtgctcatt
cccctggcctgctacctggtcatcggcacgtccttcatcctctcgggcttcgtggccctg
ttccacatccggagggtgatgaagacgggcggcgagaacacggacaagctggagaagctc
atggtgcgtatcgggctcttctctgtgctgtacaccgtgccggccacctgtgtgatcgcc
tgctacttttacgaacgcctcaacatggattactggaagatcctggcggcgcagcacaag
tgcaaaatgaacaaccagactaaaacgctggactgcctgatggccgcctccatccccgcc
gtggagatcttcatggtgaagatctttatgctgctggtggtggggatcaccagcgggatg
tggatttggacctccaagactctgcagtcctggcagcaggtgtgcagccgtaggttaaag
aagaagagccggagaaaaccggccagcgtgatcaccagcggtgggatttacaaaaaagcc
cagcatccccagaaaactcaccacgggaaatatgagatccctgcccagtcgcccacctgc
gtgtga

KEGG   Homo sapiens (human): 2535Help
Entry
2535              CDS       T01001                                 

Gene name
FZD2, Fz2, OMOD2, fz-2, fzE2, hFz2
Definition
(RefSeq) frizzled class receptor 2
  KO
K02235  frizzled 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H02154  Omodysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    2535 (FZD2)
   04390 Hippo signaling pathway
    2535 (FZD2)
   04150 mTOR signaling pathway
    2535 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2535 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    2535 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2535 (FZD2)
   05205 Proteoglycans in cancer
    2535 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2535 (FZD2)
   05226 Gastric cancer
    2535 (FZD2)
   05217 Basal cell carcinoma
    2535 (FZD2)
   05224 Breast cancer
    2535 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2535 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    2535 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2535 (FZD2)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  2535 (FZD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 2535
NCBI-ProteinID: NP_001457
OMIM: 600667
HGNC: 4040
Ensembl: ENSG00000180340
Vega: OTTHUMG00000181819
Pharos: Q14332(Tbio)
UniProt: Q14332 Q86UZ8
Structure
PDB: 

Position
17q21.31
AA seq 565 aa AA seqDB search
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcaggcctagaggtgcaccagttctatccgctggtg
aaggtgcagtgctcgcccgaactgcgcttcttcctgtgctccatgtacgcacccgtgtgc
accgtgctggaacaggccatcccgccgtgccgctctatctgtgagcgcgcgcgccagggc
tgcgaagccctcatgaacaagttcggttttcagtggcccgagcgcctgcgctgcgagcac
ttcccgcgccacggcgccgagcagatctgcgtcggccagaaccactccgaggacggagct
cccgcgctactcaccaccgcgccgccgccgggactgcagccgggtgccgggggcaccccg
ggtggcccgggcggcggcggcgctcccccgcgctacgccacgctggagcaccccttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagctacaagtttctgggcgagcgtgat
tgtgctgcgccctgcgaacctgcgcggcccgatggttccatgttcttctcacaggaggag
acgcgtttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcttccaccttc
ttcactgtcaccacgtacttggtagacatgcagcgcttccgctacccagagcggcctatc
atttttctgtcgggctgctacaccatggtgtcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtggtgtgcaacgagcgcttctccgaggacggttaccgcacggtggtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agctccatctggtgggtcatcctgtcgctcacctggttcctggcagccggcatgaagtgg
ggccacgaggccatcgaggccaactctcagtacttccacctggccgcctgggccgtgccg
gccgtcaagaccatcaccatcctggccatgggccagatcgacggcgacctgctgagcggc
gtgtgcttcgtaggcctcaacagcctggacccgctgcggggcttcgtgctagcgccgctc
ttcgtgtacctgttcatcggcacgtccttcctcctggccggcttcgtgtcgctcttccgc
atccgcaccatcatgaagcacgacggcaccaagaccgaaaagctggagcggctcatggtg
cgcatcggcgtcttctccgtgctctacacagtgcccgccaccatcgtcatcgcttgctac
ttctacgagcaggccttccgcgagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcgcccgacttcacggtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tcgggcaagacgctgcactcgtggaggaagttctacactcgcctcaccaacagccgacac
ggtgagaccaccgtgtga

KEGG   Homo sapiens (human): 7855Help
Entry
7855              CDS       T01001                                 

Gene name
FZD5, C2orf31, HFZ5
Definition
(RefSeq) frizzled class receptor 5
  KO
K02375  frizzled 5/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7855 (FZD5)
   04390 Hippo signaling pathway
    7855 (FZD5)
   04150 mTOR signaling pathway
    7855 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7855 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7855 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7855 (FZD5)
   05205 Proteoglycans in cancer
    7855 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7855 (FZD5)
   05226 Gastric cancer
    7855 (FZD5)
   05217 Basal cell carcinoma
    7855 (FZD5)
   05224 Breast cancer
    7855 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7855 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7855 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7855 (FZD5)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  7855 (FZD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 7855
NCBI-ProteinID: NP_003459
OMIM: 601723
HGNC: 4043
Ensembl: ENSG00000163251
Vega: OTTHUMG00000154790
Pharos: Q13467(Tbio)
UniProt: Q13467
Structure
PDB: 

Position
2q33.3
AA seq 585 aa AA seqDB search
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGG
ECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcctgacccatccgcgccgccctcgctgttgctgctgctcctagcgcagctg
gtgggccgggcggccgccgcgtccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccaatgctcgccg
gacctgcgcttcttcctatgctctatgtacacgcccatctgtctgcccgactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctgatg
cgccagtacggcttcgcctggcccgagcgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctctgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcctttcccagccaagcccacccttccaggcccgccaggggcgccggcctcggggggc
gaatgccccgctgggggcccgttcgtgtgcaagtgtcgcgagcccttcgtgcccattctg
aaggagtcacacccgctctacaacaaggtgcggacgggccaggtgcccaactgcgcggta
ccctgctaccagccgtccttcagtgccgacgagcgcacgttcgccaccttctggataggc
ctgtggtcggtgctgtgcttcatctccacgtccaccacagtggccaccttcctcatcgac
atggaacgcttccgctatcctgagcgccccatcatcttcctgtcagcctgctacctgtgc
gtgtcgctgggcttcctggtgcgtctggtcgtgggccatgccagcgtggcctgcagccgc
gagcacaaccacatccactacgagaccacgggccctgcactgtgcaccatcgtcttcctc
ctggtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcctggccgccggcatgaagtggggcaacgaggccatcgcgggctacgcgcagtacttc
cacctggctgcgtggctcatccccagcgtcaagtccatcacggcactggcgctgagctcc
gtggacggggacccagtggccggcatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggcacgctcttcctgctg
gcgggcttcgtgtcgctcttccgcatccgcagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcatcggcatcttcacgctgctctacacggtcccc
gccagcattgtggtggcctgctacctgtacgagcagcactaccgcgagagctgggaggcg
gcgctcacctgcgcctgcccgggccacgacaccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggcgtctgg
atctggtcgggcaagacggtggagtcgtggcggcgtttcaccagccgctgctgctgccgc
ccgcggcgcggccacaagagcgggggcgccatggccgcaggggactaccccgaggcgagc
gccgcgctcacaggcaggaccgggccgccgggccccgccgccacctaccacaagcaggtg
tccctgtcgcacgtgtag

KEGG   Homo sapiens (human): 7976Help
Entry
7976              CDS       T01001                                 

Gene name
FZD3, Fz-3
Definition
(RefSeq) frizzled class receptor 3
  KO
K02329  frizzled 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7976 (FZD3)
   04390 Hippo signaling pathway
    7976 (FZD3)
   04150 mTOR signaling pathway
    7976 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7976 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7976 (FZD3)
  09158 Development
   04360 Axon guidance
    7976 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7976 (FZD3)
   05206 MicroRNAs in cancer
    7976 (FZD3)
   05205 Proteoglycans in cancer
    7976 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7976 (FZD3)
   05226 Gastric cancer
    7976 (FZD3)
   05217 Basal cell carcinoma
    7976 (FZD3)
   05224 Breast cancer
    7976 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7976 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7976 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7976 (FZD3)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  7976 (FZD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz DUF898
Motif
Other DBs
NCBI-GeneID: 7976
NCBI-ProteinID: NP_059108
OMIM: 606143
HGNC: 4041
Ensembl: ENSG00000104290
Vega: OTTHUMG00000102145
Pharos: Q9NPG1(Tbio)
UniProt: Q9NPG1
Position
8p21.1
AA seq 666 aa AA seqDB search
MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctatgacttggattgtcttctctctttggcccttgactgtgttcatggggcatata
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagctttg
gcaatggagccattccaccctatggtgaatctggattgttctcgggatttccggcctttt
ctttgtgcactctacgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccatatcctcgactt
gtggatctgaatttagctggagaaccaactgaaggagccccagtggcagtgcagagagac
tatggtttttggtgtccccgagagttaaaaattgatcctgatctgggttattcttttctg
catgtgcgtgattgttcacctccttgtccaaatatgtacttcagaagagaagaactgtca
tttgctcgctatttcataggattgatttcaatcatttgcctctcggccacattgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaaggcctattatattt
tatgcagtctgctacatgatggtatccttaattttcttcattggatttttgcttgaagat
cgagtagcctgcaatgcatccatccctgcacaatataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatgatactctatttttttactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcacgccagtgcatggggcatccccgga
actctaaccatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattagtgaagtttatgatccgg
atcggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccggggcatctgggaaacaacgtggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacttgattctcttt
ctgatgaaatacctgatggctctcatagttggcattccctctgtattttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcagtctctcctgagggatcca
aatactcctatcataagaaagtcaaggggaacttccactcaaggaacatccacccatgct
tcttcaactcagctggctatggtggatgatcaaagaagcaaagcaggaagcatccacagc
aaagtgagcagctaccacggcagcctccacagatcacgtgatggcaggtacacgccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactaacagatcac
tccaggcatagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtaataatcccatgactcatatcacacatggcaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Homo sapiens (human): 8321Help
Entry
8321              CDS       T01001                                 

Gene name
FZD1
Definition
(RefSeq) frizzled class receptor 1
  KO
K02432  frizzled 1/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8321 (FZD1)
   04390 Hippo signaling pathway
    8321 (FZD1)
   04150 mTOR signaling pathway
    8321 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8321 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8321 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8321 (FZD1)
   05205 Proteoglycans in cancer
    8321 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8321 (FZD1)
   05226 Gastric cancer
    8321 (FZD1)
   05217 Basal cell carcinoma
    8321 (FZD1)
   05224 Breast cancer
    8321 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8321 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8321 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8321 (FZD1)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8321 (FZD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 8321
NCBI-ProteinID: NP_003496
OMIM: 603408
HGNC: 4038
Ensembl: ENSG00000157240
Vega: OTTHUMG00000023046
Pharos: Q9UP38(Tbio)
UniProt: Q9UP38
Position
7q21.13
AA seq 647 aa AA seqDB search
MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLW
LLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPIS
IPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL
EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTP
SLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPC
EPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSG
CYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVG
LNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVF
SVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDF
TVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccgggccgccggcggtggcgcgagctgggaa
ctttgtgccggggcgctctcggcccggctggcggaggagggcagcggggacgccggtggc
cgccgccgcccgccagttgacccccggcgattggcgcgccagctgctgctgctgctttgg
ctgctggaggctccgctgctgctgggggtccgggcccaggcggcgggccaggggccaggc
caggggcccgggccggggcagcaaccgccgccgccgcctcagcagcaacagagcgggcag
cagtacaacggcgagcggggcatctccgtcccggaccacggctattgccagcccatctcc
atcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctgctgggccac
acgaaccaggaggacgcgggcctggaggtgcaccagttctaccctctagtgaaagtgcag
tgttccgctgagctcaagttcttcctgtgctccatgtacgcgcccgtgtgcaccgtgcta
gagcaggcgctgccgccctgccgctccctgtgcgagcgcgcgcgccagggctgcgaggcg
ctcatgaacaagttcggcttccagtggccagacacgctcaagtgtgagaagttcccggtg
cacggcgccggcgagctgtgcgtgggccagaacacgtccgacaagggcaccccgacgccc
tcgctgcttccagagttctggaccagcaaccctcagcacggcggcggagggcaccgtggc
ggcttcccggggggcgccggcgcgtcggagcgaggcaagttctcctgcccgcgcgccctc
aaggtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgcaccttgt
gagccgaccaaggtgtatgggctcatgtacttcgggcccgaggagctgcgcttctcgcgc
acctggattggcatttggtcagtgctgtgctgcgcctccacgctcttcacggtgcttacg
tacctggtggacatgcggcgcttcagctacccggagcggcccatcatcttcttgtccggc
tgttacacggccgtggccgtggcctacatcgccggcttcctcctggaagaccgagtggtg
tgtaatgacaagttcgccgaggacggggcacgcactgtggcgcagggcaccaagaaggag
ggctgcaccatcctcttcatgatgctctacttcttcagcatggccagctccatctggtgg
gtgatcctgtcgctcacctggttcctggcggctggcatgaagtggggccacgaggccatc
gaagccaactcacagtattttcacctggccgcctgggctgtgccggccatcaagaccatc
accatcctggcgctgggccaggtggacggcgatgtgctgagcggagtgtgcttcgtgggg
cttaacaacgtggacgcgctgcgtggcttcgtgctggcgcccctcttcgtgtacctgttt
atcggcacgtcctttctgctggccggctttgtgtcgctcttccgcatccgcaccatcatg
aagcacgatggcaccaagaccgagaagctggagaagctcatggtgcgcattggcgtcttc
agcgtgctgtacactgtgccagccaccatcgtcatcgcctgctacttctacgagcaggcc
ttccgggaccagtgggaacgcagctgggtggcccagagctgcaagagctacgctatcccc
tgccctcacctccaggcgggcggaggcgccccgccgcacccgcccatgagcccggacttc
acggtcttcatgattaagtaccttatgacgctgatcgtgggcatcacgtcgggcttctgg
atctggtccggcaagaccctcaactcctggaggaagttctacacgaggctcaccaacagc
aaacaaggggagactacagtctga

KEGG   Homo sapiens (human): 8322Help
Entry
8322              CDS       T01001                                 

Gene name
FZD4, CD344, EVR1, FEVR, FZD4S, Fz-4, Fz4, FzE4, GPCR, hFz4
Definition
(RefSeq) frizzled class receptor 4
  KO
K02354  frizzled 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00589  Familial exudative vitreoretinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8322 (FZD4)
   04390 Hippo signaling pathway
    8322 (FZD4)
   04150 mTOR signaling pathway
    8322 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8322 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8322 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8322 (FZD4)
   05205 Proteoglycans in cancer
    8322 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8322 (FZD4)
   05226 Gastric cancer
    8322 (FZD4)
   05217 Basal cell carcinoma
    8322 (FZD4)
   05224 Breast cancer
    8322 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8322 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8322 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8322 (FZD4)
   04090 CD molecules [BR:hsa04090]
    8322 (FZD4)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8322 (FZD4)
CD molecules [BR:hsa04090]
 Proteins
  8322 (FZD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz DUF5083 Chol_subst-bind
Motif
Other DBs
NCBI-GeneID: 8322
NCBI-ProteinID: NP_036325
OMIM: 604579
HGNC: 4042
Ensembl: ENSG00000174804
Vega: OTTHUMG00000167231
Pharos: Q9ULV1(Tbio)
UniProt: Q9ULV1
Structure
PDB: 

Position
11q14.2
AA seq 537 aa AA seqDB search
MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgagcgtcccgggggcgcccgggggcgtcggtctcagt
ctggggttgctcctgcagttgctgctgctcctggggccggcgcggggcttcggggacgag
gaagagcggcgctgcgaccccatccgcatctccatgtgccagaacctcggctacaacgtg
accaagatgcccaacctggttgggcacgagctgcagacggacgccgagctgcagctgaca
actttcacaccgctcatccagtacggctgctccagccagctgcagttcttcctttgttct
gtttatgtgccaatgtgcacagagaagatcaacatccccattggcccatgcggcggcatg
tgtctttcagtcaagagacgctgtgaacccgtcctgaaggaatttggatttgcctggcca
gagagtctgaactgcagcaaattcccaccacagaacgaccacaaccacatgtgcatggaa
gggccaggtgatgaagaggtgcccttacctcacaaaacccccatccagcctggggaagag
tgtcactctgtgggaaccaattctgatcagtacatctgggtgaaaaggagcctgaactgt
gtgctcaagtgtggctatgatgctggcttatacagccgctcagccaaggagttcactgat
atctggatggctgtgtgggccagcctgtgtttcatctccactgccttcacagtactgacc
ttcctgatcgattcttctaggttttcctaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggata
tcctgtgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgg
gttattctgacactcacttggtttttggcagcaggactcaaatggggtcatgaagccatt
gaaatgcacagctcttatttccacattgcagcctgggccatccccgcagtgaaaaccatt
gtcatcttgattatgagactggtggatgcagatgaactgactggcttgtgctatgttgga
aaccaaaatctcgatgccctcaccgggttcgtggtggctcccctctttacttatttggtc
attggaactttgttcattgctgcaggtttggtggccttgttcaaaattcggtcaaatctt
caaaaggatgggacaaagacagacaagttagaaagactgatggtcaagattggggtgttc
tcagtactgtacacagttcctgcaacgtgtgtgattgcctgttatttttatgaaatctcc
aactgggcactttttcggtattctgcagatgattccaacatggctgttgaaatgttgaaa
atttttatgtctttgttggtgggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcagaagtgttccaacagattggtgaattctggaaaggtaaagagagag
aagagaggaaatggttgggtgaagcctggaaaaggcagtgagactgtggtataa

KEGG   Homo sapiens (human): 8323Help
Entry
8323              CDS       T01001                                 

Gene name
FZD6, FZ-6, FZ6, HFZ6, NDNC10
Definition
(RefSeq) frizzled class receptor 6
  KO
K02376  frizzled 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H01307  Nonsyndromic congenital nail disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8323 (FZD6)
   04390 Hippo signaling pathway
    8323 (FZD6)
   04150 mTOR signaling pathway
    8323 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8323 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8323 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8323 (FZD6)
   05205 Proteoglycans in cancer
    8323 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8323 (FZD6)
   05226 Gastric cancer
    8323 (FZD6)
   05217 Basal cell carcinoma
    8323 (FZD6)
   05224 Breast cancer
    8323 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8323 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8323 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8323 (FZD6)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8323 (FZD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Folate_rec DUF898 RseC_MucC Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 8323
NCBI-ProteinID: NP_001158087
OMIM: 603409
HGNC: 4044
Ensembl: ENSG00000164930
Vega: OTTHUMG00000164840
Pharos: O60353(Tbio)
UniProt: O60353 A0A024R9E9
Position
8q22.3
AA seq 706 aa AA seqDB search
MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEH
FLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREV
KADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITD
TGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtttacatttttgttgacgtgtatttttctacccctcctaagagggcacagt
ctcttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgacg
tttttccctaatctgatgggtcattatgaccagagtattgccgcggtggaaatggagcat
tttcttcctctcgcaaatctggaatgttcaccaaacattgaaactttcctctgcaaagca
tttgtaccaacctgcatagaacaaattcatgtggttccaccttgtcgtaaactttgtgag
aaagtatattctgattgcaaaaaattaattgacacttttgggatccgatggcctgaggag
cttgaatgtgacagattacaatactgtgatgagactgttcctgtaacttttgatccacac
acagaatttcttggtcctcagaagaaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggatataagtttctgggaattgaccag
tgtgcgcctccatgccccaacatgtattttaaaagtgatgagctagagtttgcaaaaagt
tttattggaacagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgttagaagattcagatacccagagagaccaattatatattactctgtctgt
tacagcattgtatctcttatgtacttcattggatttttgctaggcgatagcacagcctgc
aataaggcagatgagaagctagaacttggtgacactgttgtcctaggctctcaaaataag
gcttgcaccgttttgttcatgcttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccatc
gagcaaaaagcagtgtggtttcatgctgttgcatggggaacaccaggtttcctgactgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggagtttgctttgttggc
ctttatgacctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gttgggctctctcttcttttagctggcattatttccttaaatcatgttcgacaagtcata
caacatgatggccggaaccaagaaaaactaaagaaatttatgattcgaattggagtcttc
agcggcttgtatcttgtgccattagtgacacttctcggatgttacgtctatgagcaagtg
aacaggattacctgggagataacttgggtctctgatcattgtcgtcagtaccatatccca
tgtccttatcaggcaaaagcaaaagctcgaccagaattggctttatttatgataaaatac
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggaatcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactataaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacc
agcacaggagctacagcaaatcatggcacttctgcagtagcaattactagccatgattac
ctaggacaagaaactttgacagaaatccaaacctcaccagaaacatcaatgagagaggtg
aaagcggacggagctagcacccccaggttaagagaacaggactgtggtgaacctgcctcg
ccagcagcatccatctccagactctctggggaacaggtcgacgggaagggccaggcaggc
agtgtatctgaaagtgcgcggagtgaaggaaggattagtccaaagagtgatattactgac
actggcctggcacagagcaacaatttgcaggtccccagttcttcagaaccaagcagcctc
aaaggttccacatctctgcttgttcacccggtttcaggagtgagaaaagagcagggaggt
ggttgtcattcagatacttga

KEGG   Homo sapiens (human): 8324Help
Entry
8324              CDS       T01001                                 

Gene name
FZD7, FzE3
Definition
(RefSeq) frizzled class receptor 7
  KO
K02432  frizzled 1/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00031  Breast cancer
H00048  Hepatocellular carcinoma
Drug target
Vantictumab: D10410
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8324 (FZD7)
   04390 Hippo signaling pathway
    8324 (FZD7)
   04150 mTOR signaling pathway
    8324 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8324 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8324 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8324 (FZD7)
   05205 Proteoglycans in cancer
    8324 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8324 (FZD7)
   05226 Gastric cancer
    8324 (FZD7)
   05217 Basal cell carcinoma
    8324 (FZD7)
   05224 Breast cancer
    8324 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8324 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8324 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8324 (FZD7)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8324 (FZD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 8324
NCBI-ProteinID: NP_003498
OMIM: 603410
HGNC: 4045
Ensembl: ENSG00000155760
Vega: OTTHUMG00000132841
Pharos: O75084(Tbio)
UniProt: O75084
Structure
PDB: 

Position
2q33.1
AA seq 574 aa AA seqDB search
MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaccccggcgcggccgctccgctttcgtccctgggcctctgtgccctggtgctg
gcgctgctgggcgcactgtccgcgggcgccggggcgcagccgtaccacggagagaagggc
atctccgtgccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgaactccgcttt
ttcttatgctccatgtatgcgcccgtgtgcaccgtgctcgatcaggccatcccgccgtgt
cgttctctgtgcgagcgcgcccgccagggctgcgaggcgctcatgaacaagttcggcttc
cagtggcccgagcggctgcgctgcgagaacttcccggtgcacggtgcgggcgagatctgc
gtgggccagaacacgtcggacggctccgggggcccaggcggcggccccactgcctaccct
accgcgccctacctgccggacctgcccttcaccgcgctgcccccgggggcctcagatggc
agggggcgtcccgccttccccttctcatgcccccgtcagctcaaggtgcccccgtacctg
ggctaccgcttcctgggtgagcgcgattgtggcgccccgtgcgaaccgggccgtgccaac
ggcctgatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tccgtgctgtgctgcgcctcgacgctctttaccgttctcacctacctggtggacatgcgg
cgcttcagctacccagagcggcccatcatcttcctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttccttctagaggaccgcgccgtgtgcgtggagcgcttctcg
gacgatggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atggtgctctacttcttcggcatggccagctccatctggtgggtcattctgtctctcact
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggccaactcgcagtac
ttccacctggccgcgtgggccgtgcccgccgtcaagaccatcactatcctggccatgggc
caggtagacggggacctgctgagcggggtgtgctacgttggcctctccagtgtggacgcg
ctgcggggcttcgtgctggcgcctctgttcgtctacctcttcataggcacgtccttcttg
ctggccggcttcgtgtccctcttccgtatccgcaccatcatgaaacacgacggcaccaag
accgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacacagtg
cccgccaccatcgtcctggcctgctacttctacgagcaggccttccgcgagcactgggag
cgcacctggctcctgcagacgtgcaagagctatgccgtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtc
ggcatcaccactggcttctggatctggtcgggcaagaccctgcagtcgtggcgccgcttc
taccacagacttagccacagcagcaagggggagactgcggtatga

KEGG   Homo sapiens (human): 8325Help
Entry
8325              CDS       T01001                                 

Gene name
FZD8, FZ-8, hFZ8
Definition
(RefSeq) frizzled class receptor 8
  KO
K02375  frizzled 5/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8325 (FZD8)
   04390 Hippo signaling pathway
    8325 (FZD8)
   04150 mTOR signaling pathway
    8325 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8325 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8325 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8325 (FZD8)
   05205 Proteoglycans in cancer
    8325 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8325 (FZD8)
   05226 Gastric cancer
    8325 (FZD8)
   05217 Basal cell carcinoma
    8325 (FZD8)
   05224 Breast cancer
    8325 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8325 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8325 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8325 (FZD8)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8325 (FZD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz 7tm_2 PhaG_MnhG_YufB
Motif
Other DBs
NCBI-GeneID: 8325
NCBI-ProteinID: NP_114072
OMIM: 606146
HGNC: 4046
Ensembl: ENSG00000177283
Vega: OTTHUMG00000017956
Pharos: Q9H461(Tbio)
UniProt: Q9H461
Structure
PDB: 

Position
10p11.21
AA seq 694 aa AA seqDB search
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGS
GHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMVS
VSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFL
IDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAGA
GAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLT
WFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDN
LRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLY
TVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITS
GVWVWSGKTLESWRSLCTRCCWASKGAAVGGGAGATAAGGGGGPGGGGGGGPGGGGGPGG
GGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctgctggccgccttggcgctgctgcag
cgctctagcggcgctgcggccgcctcggccaaggagctggcatgccaagagatcaccgtg
ccgctgtgtaagggcatcggctacaactacacctacatgcccaatcagttcaaccacgac
acgcaagacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccagtgc
tcgcccgatctcaagttcttcctgtgcagcatgtacacgcccatctgcctagaggactac
aagaagccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgcccgag
caaggcaaccctgacacgctgtgcatggactacaaccgcaccgacctaaccaccgccgcg
cccagcccgccgcgccgcctgccgccgccgccgcccggcgagcagccgccttcgggcagc
ggccacggccgcccgccgggggccaggcccccgcaccgcggcggcggcaggggcggtggc
ggcggggacgcggcggcgcccccagctcgcggcggcggcggtggcgggaaggcgcggccc
cctggcggcggcgcggctccctgcgagcccgggtgccagtgccgcgcgcctatggtgagc
gtgtccagcgagcgccacccgctctacaaccgcgtcaagacaggccagatcgctaactgc
gcgctgccctgccacaacccctttttcagccaggacgagcgcgccttcaccgtcttctgg
atcggcctgtggtcggtgctctgcttcgtgtccaccttcgccaccgtctccaccttcctt
atcgacatggagcgcttcaagtacccggagcggcccattatcttcctctcggcctgctac
ctcttcgtgtcggtgggctacctagtgcgcctggtggcgggccacgagaaggtggcgtgc
agcggtggcgcgccgggcgcggggggcgctgggggcgcgggcggcgcggcggcgggcgcg
ggcgcggcgggcgcgggcgcgggcggcccgggcgggcgcggcgagtacgaggagctgggc
gcggtggagcagcacgtgcgctacgagaccaccggccccgcgctgtgcaccgtggtcttc
ttgctggtctacttcttcggcatggccagctccatctggtgggtgatcttgtcgctcaca
tggttcctggcggccggtatgaagtggggcaacgaagccatcgccggctactcgcagtac
ttccacctggccgcgtggcttgtgcccagcgtcaagtccatcgcggtgctggcgctcagc
tcggtggacggcgacccggtggcgggcatctgctacgtgggcaaccagagcctggacaac
ctgcgcggcttcgtgctggcgccgctggtcatctacctcttcatcggcaccatgttcctg
ctggccggcttcgtgtccctcttccgcatccgctcggtcatcaagcaacaggacggcccc
accaagacgcacaagctggagaagctgatgatccgcctgggcctgttcaccgtgctctac
accgtgcccgccgcggtggtggtcgcctgcctcttctacgagcagcacaaccgcccgcgc
tgggaggccacgcacaactgcccgtgcctgcgggacctgcagcccgaccaggcacgcagg
cccgactacgccgtcttcatgctcaagtacttcatgtgcctagtggtgggcatcacctcg
ggcgtgtgggtctggtccggcaagacgctggagtcctggcgctccctgtgcacccgctgc
tgctgggccagcaagggcgccgcggtgggcgggggcgcgggcgccacggccgcggggggt
ggcggcgggccggggggcggcggcggcgggggacccggcggcggcggggggccgggcggc
ggcgggggctccctctacagcgacgtcagcactggcctgacgtggcggtcgggcacggcg
agctccgtgtcttatccaaagcagatgccattgtcccaggtctga

KEGG   Homo sapiens (human): 8326Help
Entry
8326              CDS       T01001                                 

Gene name
FZD9, CD349, FZD3
Definition
(RefSeq) frizzled class receptor 9
  KO
K02842  frizzled 9/10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8326 (FZD9)
   04390 Hippo signaling pathway
    8326 (FZD9)
   04150 mTOR signaling pathway
    8326 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8326 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8326 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8326 (FZD9)
   05205 Proteoglycans in cancer
    8326 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8326 (FZD9)
   05226 Gastric cancer
    8326 (FZD9)
   05217 Basal cell carcinoma
    8326 (FZD9)
   05224 Breast cancer
    8326 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8326 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8326 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8326 (FZD9)
   04090 CD molecules [BR:hsa04090]
    8326 (FZD9)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8326 (FZD9)
CD molecules [BR:hsa04090]
 Proteins
  8326 (FZD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 8326
NCBI-ProteinID: NP_003499
OMIM: 601766
HGNC: 4047
Ensembl: ENSG00000188763
Vega: OTTHUMG00000023051
Pharos: O00144(Tbio)
UniProt: O00144
Position
7q11.23
AA seq 591 aa AA seqDB search
MAVAPLRGALLLWQLLAAGGAALEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPA
RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CYRKIAAGRARAKACRAPGSYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggcgcctctgcggggggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcactggagatcggccgcttcgacccggagcgcgggcgcggggctgcgccgtgccag
gcggtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtcgcagggcgaggcggctgccgagctagcggagttcgcgccgctggtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcgcccatgtgc
accgaccaggtctcgacgcccattcccgcctgccggcccatgtgcgagcaggcgcgcctg
cgctgcgcgcccatcatggagcagttcaacttcggctggccggactcgctcgactgcgcc
cggctgcccacgcgcaacgacccgcacgcgctgtgcatggaggcgcccgagaacgccacg
gccggccccgcggagccccacaagggcctgggcatgctgcccgtggcgccgcggcccgcg
cgccctcccggagacctgggcccgggcgcgggcggcagtggcacctgcgagaaccccgag
aagttccagtacgtggagaagagccgctcgtgcgcaccgcgctgcgggcccggcgtcgag
gtgttctggtcccggcgcgacaaggacttcgcgctggtctggatggccgtgtggtcggcg
ctgtgcttcttctccaccgccttcactgtgctcaccttcttgctggagccccaccgcttc
cagtaccccgagcgccccatcatcttcctctccatgtgctacaacgtctactcgctggcc
ttcctgatccgtgcggtggccggagcgcagagcgtggcctgtgaccaggaggcgggcgcg
ctctacgtgatccaggagggcctggagaacacgggctgcacgctggtcttcctactgctc
tactacttcggcatggccagctcgctctggtgggtggtcctgacgctcacctggttcctg
gctgccgggaagaaatggggccacgaggccatcgaggcccacggcagctatttccacatg
gctgcctggggcctgcccgcgctcaagaccatcgtcatcctgaccctgcgcaaggtggcg
ggtgatgagctgactgggctttgctacgtggccagcacggatgcagcagcgctcacgggc
ttcgtgctggtgcccctctctggctacctggtgctgggcagtagtttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagacgggcggcaccaacacagagaag
ctggagaagctcatggtcaagatcggggtcttctccatcctctacacggtgcccgccacc
tgcgtcatcgtttgctatgtctacgaacgcctcaacatggacttctggcgccttcgggcc
acagagcagccatgcgcagcggccgcggggcccggaggccggagggactgctcgctgcca
gggggctcggtgcccaccgtggcggtcttcatgctcaaaattttcatgtcactggtggtg
gggatcaccagcggcgtctgggtgtggagctccaagactttccagacctggcagagcctg
tgctaccgcaagatagcagctggccgggcccgggccaaggcctgccgcgcccccgggagc
tacggacgtggcacgcactgccactataaggctcccaccgtggtcttgcacatgactaag
acggacccctctttggagaaccccacacacctctag

DBGET integrated database retrieval system