KEGG   Homo sapiens (human): 11212Help
Entry
11212             CDS       T01001                                 

Gene name
PLPBP, EPVB6D, PROSC
Definition
(RefSeq) pyridoxal phosphate binding protein
  KO
K06997  PLP dependent protein
Organism
hsa  Homo sapiens (human)
Disease
H02250  Early-onset vitamin B6-dependent epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    11212 (PLPBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ala_racemase_N
Motif
Other DBs
NCBI-GeneID: 11212
NCBI-ProteinID: NP_009129
OMIM: 604436
HGNC: 9457
Ensembl: ENSG00000147471
Vega: OTTHUMG00000164024
Pharos: O94903(Tbio)
UniProt: O94903
Position
8p11.23
AA seq 275 aa AA seqDB search
MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGH
GQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSV
KLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGL
MTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNV
RIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtggagagctggcagcatgtcggccgagctgggagtcgggtgcgcattgcgggcggtg
aacgagcgcgtgcagcaggctgtggcgcggcggccgcgggatctcccagccatccagccc
cggctagtggcggtcagcaaaaccaaacctgcagacatggtgatcgaggcctatggacat
gggcagcgcacttttggcgagaactacgttcaggaactgctagaaaaagcatcaaatccc
aaaattctgtctttgtgtcctgagatcaaatggcacttcattggccacctacagaaacaa
aatgtcaacaaattgatggctgtccccaatctcttcatgctggaaacagtggattctgtg
aagttggcagacaaagtgaacagttcctggcagagaaaaggttctcctgaaaggttaaag
gttatggtccagattaacaccagcggagaagagagtaaacatggccttccaccttcagag
accatagccatcgtggagcacataaacgccaagtgtcctaacctggagtttgtggggctg
atgaccataggaagctttgggcatgatcttagtcaaggaccaaatccagacttccagctg
ttattgtccctccgggaggagctgtgtaaaaagctgaacatccctgctgaccaggttgag
ctgagcatgggcatgtccgcggatttccagcatgcggttgaagtaggatctacaaatgtc
cgaataggaagcacgatttttggagagcgggattactcaaagaaacccaccccggacaag
tgcgcagcagacgtgaaggccccgctggaggtggcacaggagcactga

DBGET integrated database retrieval system