KEGG   Homo sapiens (human): 11219Help
Entry
11219             CDS       T01001                                 

Gene name
TREX2
Definition
(RefSeq) three prime repair exonuclease 2
  KO
K10791  three prime repair exonuclease 2 [EC:3.1.11.2]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    11219 (TREX2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     11219 (TREX2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Nucleases
    11219 (TREX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_T
Motif
Other DBs
NCBI-GeneID: 11219
NCBI-ProteinID: NP_542432
OMIM: 300370
HGNC: 12270
Ensembl: ENSG00000183479
Vega: OTTHUMG00000159319
Pharos: Q9BQ50(Tbio)
UniProt: Q9BQ50
Structure
PDB: 

Position
Xq28
AA seq 236 aa AA seqDB search
MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKL
TLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGF
DYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYF
RAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggcaccccgggccgagacctttgtcttcctggacctggaagccactgggctc
cccagtgtggagcccgagattgccgagctgtccctctttgctgtccaccgctcctccctg
gagaacccggagcacgacgagtctggtgccctagtattgccccgggtcctggacaagctc
acgctgtgcatgtgcccggagcgccccttcactgccaaggccagcgagatcaccggcctg
agcagtgagggcctggcgcgatgccggaaggctggctttgatggcgccgtggtgcggacg
ctgcaggccttcctgagccgccaggcagggcccatctgccttgtggcccacaatggcttt
gattatgatttccccctgctgtgtgccgagctgcggcgcctgggtgcccgcctgccccgg
gacactgtctgcctggacacgctgccggccctgcggggcctggaccgcgcccacagccac
ggcacccgggcccggggccgccagggttacagcctcggcagcctcttccaccgctacttc
cgggcagagccaagcgcagcccactcagccgagggcgacgtgcacaccctgctcctgatc
ttcctgcaccgcgccgcagagctgctcgcctgggccgatgagcaggcccgtgggtgggcc
cacatcgagcccatgtacttgccgcctgatgaccccagcctggaggcctga

DBGET integrated database retrieval system