KEGG   Homo sapiens (human): 11231
Entry
11231             CDS       T01001                                 

Symbol
SEC63, DNAJC23, ERdj2, PCLD2, PRO2507, SEC63L
Name
(RefSeq) SEC63 homolog, protein translocation regulator
  KO
K09540  translocation protein SEC63
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00545  Polycystic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    11231 (SEC63)
   04141 Protein processing in endoplasmic reticulum
    11231 (SEC63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    11231 (SEC63)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    11231 (SEC63)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   11231 (SEC63)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   11231 (SEC63)
SSDB
Motif
Pfam: Sec63 DnaJ
Other DBs
NCBI-GeneID: 11231
NCBI-ProteinID: NP_009145
OMIM: 608648
HGNC: 21082
Ensembl: ENSG00000025796
Vega: OTTHUMG00000015316
Pharos: Q9UGP8(Tbio)
UniProt: Q9UGP8 A0A0S2Z5M1
Position
6q21
AA seq 760 aa
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIVMARNREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDR
HTLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
EVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVL
LPQSKQQKQKQANGVVGNEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
QDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKE
QTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK
PVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggccgggcagcagttccagtacgatgacagtgggaacaccttcttctacttcctcacc
tccttcgtggggctcatcgtgatcccggcgacatactacctctggccccgagatcagaat
gccgagcaaattcgattaaagaatatcagaaaagtatatggaaggtgtatgtggtatcgt
ttacggttattaaaaccccagccaaatattattcctacagtaaagaaaatagttctgctt
gcaggatgggcattgttcttattccttgcatataaagtttccaaaacagaccgagaatac
caagaatacaatccttatgaagtattaaatttggatcctggagccacagtagcagaaatt
aaaaaacaatatcgtttgctgtcacttaaatatcatccagataaaggaggtgatgaggtt
atgttcatgaggatagcaaaagcttatgctgctttaacggatgaagagtcccggaaaaat
tgggaagaatttggaaatccagatgggcctcaagccacaagctttggaattgccctgcca
gcttggatagttgaccagaaaaactcaattctggttttacttgtatatggattggcattt
atggttatccttccagttgttgtgggctcttggtggtatcgctcaatacgctatagtgga
gaccagattctaatacgcacaacacagatttatacatactttgtttataaaacccgaaat
atggatatgaaacgtcttatcatggttttggctggagcttctgaatttgatcctcagtat
aataaagatgccacaagcagaccaacggataatattctaataccacagctaatcagagaa
attggcagcattaatttaaagaagaatgagcctccacttacctgcccatatagcctgaag
gccagagttcttttactgtctcatcttgctagaatgaaaattcctgagacccttgaagaa
gatcagcaattcatgctaaaaaagtgtcctgccctacttcaagaaatggttaatgtaatc
tgccaactaatagtaatggcccggaaccgtgaagaaagggagtttcgtgctccaactttg
gcatccctagaaaactgcatgaagctttctcagatggccgttcagggacttcagcaattt
aagtctccccttctgcagctccctcatattgaagaggacaatcttagacgggtttctaat
cataagaagtataaaattaaaactatccaggatttggtgagtttaaaagaatcagatcgt
cacactctactgcacttccttgaagatgaaaaatatgaagaggttatggctgtccttggg
agttttccatatgtgaccatggatataaaatcacaggtgttagatgatgaagatagcaac
aacatcacagtaggatccttagttacagtgttggttaagttgacaaggcaaacaatggct
gaagtatttgaaaaggagcagtccatctgtgctgcagaggaacagccagcagaagatggg
cagggtgaaactaacaagaacaggacaaaaggaggatggcaacagaagagtaaaggaccc
aagaaaactgctaaatcaaaaaaaaagaaacctttaaaaaaaaaacctacacctgtgcta
ttaccacagtcaaagcaacagaaacaaaagcaggcaaatggagtcgttgggaatgaagct
gcagtaaaggaagatgaagaagaagtttcagataagggcagtgattctgaagaagaagaa
accaatagagattcccaaagtgagaaagatgatggtagtgacagagactctgatagagag
caagatgaaaaacaaaacaaagatgatgaagcagagtggcaagaattacaacaaagcata
cagcgaaaagagagagctctattggaaaccaaatcaaaaataacacatcctgtgtatagc
ctttactttcctgaggaaaaacaagaatggtggtggctttacattgcagataggaaggag
cagacattaatatccatgccatatcatgtgtgtacgctgaaagatacagaggaggtagag
ctgaagtttcctgcaccaggcaagcctggaaattatcagtatactgtgtttctgagatca
gactcctatatgggtttggatcagattaaaccattgaagttggaagttcatgaggctaag
cctgtgccagaaaatcacccacagtgggatacagcaatagagggggatgaagaccaggag
gacagtgagggctttgaagatagctttgaggaagaagaggaggaagaagaagatgatgac
taa

KEGG   Homo sapiens (human): 7095
Entry
7095              CDS       T01001                                 

Symbol
SEC62, Dtrp1, HTP1, TLOC1, TP-1
Name
(RefSeq) SEC62 homolog, preprotein translocation factor
  KO
K12275  translocation protein SEC62
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    7095 (SEC62)
   04141 Protein processing in endoplasmic reticulum
    7095 (SEC62)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    7095 (SEC62)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   7095 (SEC62)
SSDB
Motif
Pfam: Sec62 DEP
Other DBs
NCBI-GeneID: 7095
NCBI-ProteinID: NP_003253
OMIM: 602173
HGNC: 11846
Ensembl: ENSG00000008952
Vega: OTTHUMG00000158753
Pharos: Q99442(Tbio)
UniProt: Q99442
Position
3q26.2
AA seq 399 aa
MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK
WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKE
EDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLD
GNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL
LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE
TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNG
NDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggaacgcaggagacacaagaagcggatccaggaagttggtgaaccatctaaagaa
gagaaggctgtggccaagtatcttcgattcaactgtccaacaaagtccaccaatatgatg
ggtcaccgggttgattattttattgcttcaaaagcagtggactgtcttttggattcaaag
tgggcaaaggccaagaaaggagaggaagctttatttacaaccagggagtctgtggttgac
tactgcaacaggcttttaaagaagcagttttttcaccgagccctaaaagtaatgaaaatg
aaatatgataaagacataaagaaagaaaaagataaaggaaaagctgaaagtggaaaagaa
gaagataaaaagagcaagaaagaaaatataaaggatgagaagacaaaaaaagaaaaagag
aaaaaaaaagatggtgaaaaggaagaatccaaaaaggaggaaactccaggaactcctaaa
aagaaggaaactaagaaaaaattcaaacttgagccacatgatgatcaggtttttctggat
ggaaatgaggtgtatgtatggatctatgacccagttcactttaaaacatttgtcatggga
ttaattcttgtgattgcagtaatagcggccaccctcttccccctttggccagcagaaatg
agagtaggtgtttattacctcagtgtgggtgcaggctgttttgtagccagtattcttctc
cttgctgttgctcgatgcattctatttctcatcatttggctcataactggaggaaggcac
cacttttggttcttgccaaatctgactgctgatgtgggcttcattgactccttcaggcct
ctgtacacacatgaatacaaaggaccaaaagcagacttaaagaaagatgagaagtctgaa
accaaaaagcaacagaagtccgacagtgaggaaaagtcagacagtgagaaaaaggaagat
gaggaggggaaagtaggaccaggaaatcatggaacagaaggctcggggggagaacggcat
tcagacacggacagtgacaggagggaagatgatcgatcccagcacagtagtggaaatgga
aatgattttgaaatgataacaaaagaggaactggaacagcaaacagatggggattgtgaa
gaggatgaggaagaggaaaatgatggagaaacacctaaatcttcacatgaaaaatcataa

DBGET integrated database retrieval system