KEGG   Homo sapiens (human): 11237Help
Entry
11237             CDS       T01001                                 

Gene name
RNF24, G1L
Definition
(RefSeq) ring finger protein 24
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 zf-RING_11 zf-C3HC4_2 zf-rbx1 zf-C3HC4 zf-RING_5 zf-RING_UBOX zf-C3HC4_3 zf-ANAPC11 Prok-RING_1 zf-RING_4 zf-TFIIIC Prok-RING_4 Orthoreo_P10 zf-C3H2C3 Zn_ribbon_17 RINGv
Motif
Other DBs
NCBI-GeneID: 11237
NCBI-ProteinID: NP_001127809
OMIM: 612489
HGNC: 13779
Ensembl: ENSG00000101236
Vega: OTTHUMG00000031770
Pharos: Q9Y225(Tbio)
UniProt: Q9Y225
Structure
PDB: 

Position
20p13
AA seq 148 aa AA seqDB search
MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAY
KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNM
PVLQLAQLHSKQDRGPPQGPLPGAENIV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggatttcccacattacaacttcaggatgcctaatattggattccagaatctg
cctctcaacatatatattgtggtttttggtactgctatatttgtcttcatccttagttta
ctcttctgttgctacttgattaggctaagacatcaagcacacaaagaattttatgcctac
aaacaggttatattaaaagagaaagtaaaagaattgaatttacatgagctctgtgcagtg
tgcctagaagacttcaagcctcgagatgagttggggatttgcccatgtaagcacgccttc
cacagaaagtgccttattaagtggctggaggttcgtaaagtgtgtcccctgtgcaacatg
ccagttctacagctggcccagttgcacagtaagcaggaccgtggaccccctcaggggccc
cttcctggggcagagaacattgtatag

DBGET integrated database retrieval system