KEGG   Homo sapiens (human): 11238Help
Entry
11238             CDS       T01001                                 

Gene name
CA5B, CA-VB, CAVB
Definition
(RefSeq) carbonic anhydrase 5B
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
hsa01100  Metabolic pathways
Drug target
Acetazolamide (DG01134): D00218 D01196
Clofenamide: D01822
Diclofenamide: D00518
Dorzolamide (DG01135): D00653 D07871
Ethoxzolamide: D02441
Methazolamide: D00655
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    11238 (CA5B)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     11238 (CA5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase Tudor_3
Motif
Other DBs
NCBI-GeneID: 11238
NCBI-ProteinID: NP_009151
OMIM: 300230
HGNC: 1378
Ensembl: ENSG00000169239
Vega: OTTHUMG00000021183
Pharos: Q9Y2D0(Tclin)
UniProt: Q9Y2D0 A0A024RBW9
Position
Xp22.2
AA seq 317 aa AA seqDB search
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgatgaacagcctgagggtcattcttcaagcctctccaggcaaattgctgtgg
agaaagttccagattccgagattcatgccagcgaggccctgcagcctctatacttgtact
tacaaaacccggaaccgagccttgcatccactctgggagagcgtggacctggttcctggg
ggcgatcgccagtcacccatcaacattcggtggagggacagtgtttatgatcccggctta
aaaccactgaccatctcttatgacccagccacctgcctccacgtctggaataatgggtac
tctttcctcgtggaatttgaagattctacagataaatcagtgatcaagggaggacccctg
gaacacaactaccgattgaagcagttccattttcactggggggccatcgatgcctggggt
tctgagcacaccgtggacagcaaatgcttcccagcagagctgcacttagtgcattggaac
gcagtcagatttgaaaactttgaggatgcagcactggaagaaaatggtttggctgtgata
ggagtatttttaaagctaggcaaacatcataaggagctacagaaattagtggatactttg
ccgtcaattaagcataaggacgcccttgtggaatttgggtcatttgacccttcctgcctg
atgcctacctgcccagattactggacctactcagggtctctgactaccccacccctctcc
gagtctgtcacctggatcattaagaagcaaccagtagaggttgatcatgatcagcttgag
caatttcggaccctgcttttcacttccgaaggggagaaagagaaaagaatggtggacaac
ttccgcccccttcagccactgatgaatcgcactgttcgttcatccttccggcatgattat
gtgctgaatgtacaagcgaaacccaagccggccaccagccaagcaaccccctaa

DBGET integrated database retrieval system