KEGG   Homo sapiens (human): 112398Help
Entry
112398            CDS       T01001                                 

Gene name
EGLN2, EIT-6, EIT6, HIF-PH1, HIFPH1, HPH-1, HPH-3, PHD1
Definition
(RefSeq) egl-9 family hypoxia inducible factor 2
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Drug target
Daprodustat: D10874
Enarodustat: D11523
Molidustat sodium: D11273
Roxadustat: D10593
Vadadustat: D11078
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112398 (EGLN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112398 (EGLN2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112398 (EGLN2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     112398 (EGLN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Motif
Other DBs
NCBI-GeneID: 112398
NCBI-ProteinID: NP_444274
OMIM: 606424
HGNC: 14660
Ensembl: ENSG00000269858
Vega: OTTHUMG00000182703
Pharos: Q96KS0(Tchem)
UniProt: Q96KS0 A0A024R0R2
Structure
PDB: 

Position
19q13.2
AA seq 407 aa AA seqDB search
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAG
SGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRK
WAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALD
YIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQI
AWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDN
PHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEV
KPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggacagcccgtgccagccgcagcccctaagtcaggctctccctcagttaccagggtct
tcgtcagagcccttggagcctgagcctggccgggccaggatgggagtggagagttacctg
ccctgtcccctgctcccctcctaccactgtccaggagtgcctagtgaggcctcggcaggg
agtgggacccccagagccacagccacctctaccactgccagccctcttcgggacggtttt
ggcgggcaggatggtggtgagctgcggccgctgcagagtgaaggcgctgcagcgctggtc
accaaggggtgccagcgattggcagcccagggcgcacggcctgaggcccccaaacggaaa
tgggccgaggatggtggggatgccccttcacccagcaaacggccctgggccaggcaagag
aaccaggaggcagagcgggagggtggcatgagctgcagctgcagcagtggcagtggtgag
gccagtgctgggctgatggaggaggcgctgccctctgcgcccgagcgcctggccctggac
tatatcgtgccctgcatgcggtactacggcatctgcgtcaaggacagcttcctgggggca
gcactgggcggtcgcgtgctggccgaggtggaggccctcaaacggggtgggcgcctgcga
gacgggcagctagtgagccagagggcgatcccgccgcgcagcatccgtggggaccagatt
gcctgggtggaaggccatgaaccaggctgtcgaagcattggtgccctcatggcccatgtg
gacgccgtcatccgccactgcgcagggcggctgggcagctatgtcatcaacgggcgcacc
aaggccatggtggcgtgttacccaggcaacgggctcgggtacgtaaggcacgttgacaat
ccccacggcgatgggcgctgcatcacctgtatctattacctgaatcagaactgggacgtt
aaggtgcatggcggcctgctgcagatcttccctgagggccggcccgtggtagccaacatc
gagccactctttgaccggttgctcattttctggtctgaccggcggaacccccacgaggtg
aagccagcctatgccaccaggtacgccatcactgtctggtattttgatgccaaggagcgg
gcagcagccaaagacaagtatcagctagcatcaggacagaaaggtgtccaagtacctgta
tcacagccgcctacgcccacctag

DBGET integrated database retrieval system