KEGG   Homo sapiens (human): 1124Help
Entry
1124              CDS       T01001                                 

Gene name
CHN2, ARHGAP3, BCH, CHN2-3, RHOGAP3
Definition
(RefSeq) chimerin 2
  KO
K20630  chimaerin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1124 (CHN2)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    1124 (CHN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP C1_1 SH2 zf-RING-like DUF4127
Motif
Other DBs
NCBI-GeneID: 1124
NCBI-ProteinID: NP_004058
OMIM: 602857
HGNC: 1944
Ensembl: ENSG00000106069 ENSG00000285162
Vega: OTTHUMG00000023063
Pharos: P52757(Tbio)
UniProt: P52757 A0A2X0TVW3
Structure
PDB: 

Position
7p14.3
AA seq 468 aa AA seqDB search
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKT
NVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLP
IPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtccagcaactccagcctgtccggctcgtcggtgtcctccgatgctgaagaa
taccagcctcctatatggaaatcatacttatatcagttacagcaagaggcacctcgtccc
aagagaatcatttgtcctcgggaggtggaaaacagaccaaaatattatggaagagagttt
catgggatcatctctcgggagcaggcggatgagcttcttggaggcgtggagggtgcctac
atccttagagaaagccagcggcaaccaggatgctacacgctggctctcaggtttggaaac
cagaccttaaactacaggctcttccacgacgggaaacactttgtgggtgagaagaggttt
gagtcgattcatgatctggtgacagatggcttgataacactgtacatagaaacaaaagct
gccgagtacatttcaaaaatgacaactaaccccatctatgaacacattggatatgccacc
ctactcagagaaaaagtatccagaaggctgagcaggtctaaaaatgaaccaagaaaaaca
aacgtcacacatgaagaacacacagcggtggaaaagatctcctccctggttcgaagggct
gccctcacacacaacgacaaccacttcaattatgagaagacacacaactttaaggtccac
acgttccgaggcccacactggtgtgaatattgtgccaatttcatgtgggggctcatcgcc
caaggggtccggtgctcagactgtggattgaacgtacacaaacagtgttccaagcacgtt
cccaatgactgccaacctgatctcaagaggatcaagaaagtgtactgttgtgacctcaca
acacttgtgaaggctcacaacactcagagacccatggtggtagacatatgcattcgggaa
attgaagcaagaggattaaaatcggaaggcctttacagagtctctgggttcactgaacac
attgaagatgtcaaaatggcatttgacagagatggtgaaaaggccgatatatctgccaat
gtctatccagacataaacatcatcactggagcccttaaactgtatttcagagacttaccc
atccctgtcatcacatatgatacctattccaaatttatagatgcagcaaaaatctccaat
gcagatgagaggctggaagccgtccatgaagtgctgatgctgctgcctcctgcccactat
gaaaccctccggtacctaatgatccacctcaaaaaggttactatgaatgaaaaagacaat
ttcatgaatgcagaaaatctggggatcgtgtttgggcccactctgatgaggccccctgag
gacagcaccctgaccaccctgcatgatatgcggtaccaaaagctgattgtgcagatttta
atagaaaacgaagacgttttattctaa

DBGET integrated database retrieval system