KEGG   Homo sapiens (human): 11244
Entry
11244             CDS       T01001                                 
Symbol
ZHX1
Name
(RefSeq) zinc fingers and homeoboxes 1
  KO
K24879  zinc fingers and homeoboxes protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    11244 (ZHX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ZF
    11244 (ZHX1)
SSDB
Motif
Pfam: Homeodomain zf_C2H2_ZHX Homeobox_KN Homez Cpn60_TCP1 FUSC-like
Other DBs
NCBI-GeneID: 11244
NCBI-ProteinID: NP_001017926
OMIM: 604764
HGNC: 12871
Ensembl: ENSG00000165156
UniProt: Q9UKY1
Structure
Position
8:complement(123248456..123275541)
AA seq 873 aa
MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTRAESISSDEEVHESVDSDN
QQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEH
NLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENAEQAESTEVSSSGISISK
TPIMKMMKNKVENKRIAVHHNSVEDVPEEKENEIKPDREEIVENPSSSASESNTSTSIVN
RIHPSTASTVVTPAAVLPGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNAALDNNPLLL
NTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGTV
HTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGTNTLPVTAPIALTVAGV
PSQNNIQKSQVPAAQPTAETKPATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELK
VSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIII
DSSDETTESPTVGTAQPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNR
LRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSKEEAGETSPADESGAPKSGS
TGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNL
KWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKT
GTAILKDYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELFEENEEEDE
VIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD
NT seq 2622 nt   +upstreamnt  +downstreamnt
atggcaagcaggcgaaaatcaacaacaccttgcatggtccttgccagtgaacaagatcca
gaccttgagttgatatcagatttggatgaaggtcctcctgtgcttacacctgtagaaaac
accagagcagagagtatctcaagtgatgaagaggttcatgaatctgtggattcagacaat
cagcaaaataaaaaagttgaaggtggatatgaatgtaaatattgtacttttcaaactcca
gatctaaatatgtttacttttcatgtggattcggaacatcccaatgtagtgctaaattca
tcctatgtttgtgtcgaatgcaattttcttaccaaaaggtatgatgcactttctgagcat
aatctgaaatatcacccaggagaagagaattttaagttgactatggtgaaacgtaataac
cagacaatctttgaacaaacaataaatgatctgacttttgatggtagttttgttaaagag
gagaatgcagagcaagcagaatctacagaagtttcttcttcgggaatatctatcagtaaa
actcctatcatgaaaatgatgaaaaataaagtggaaaataaacggattgcagttcatcat
aactcagttgaggacgttcctgaagagaaagagaatgaaatcaaaccagaccgtgaagaa
attgtagaaaatccaagttcttcagcttctgaatctaatacaagtacttccattgtaaac
agaatacatccaagtactgccagcacggtagtgacaccagcagcagttcttcctggattg
gcacaggtgataactgctgtatctgctcagcagaattctaatttgattcccaaagtctta
atccctgttaatagcattcccacctacaatgctgcattggataacaatccccttttactt
aacacctacaacaagttcccttacccaacaatgtcagaaattacagttctttctgctcaa
gcaaaatatacagaggaacagatcaagatatggttttcagcccaacgtttaaaacatggt
gttagttggactcccgaggaagtagaggaggcaagaaggaaacaattcaatggaacagtg
catactgtacctcagaccataactgttattcctacacacatttccacagggagtaatggt
ttaccatctattttacagacatgccaaatagttggtcagcctggtctggtccttactcaa
gtggctggaacaaacaccttgccagttacagcacctatagccttgacagtggcaggcgtt
ccaagtcaaaataatatacagaaaagtcaggtacctgctgctcagcctactgcagaaaca
aagccagcaacagcagcagttccaacttctcaaagtgtcaaacatgaaactgcattggta
aaccctgattcatttggcattcgggcaaaaaagacaaaagagcaactggcagaattaaaa
gttagctaccttaaaaatcagtttccccatgattcagaaattatcagacttatgaaaata
acaggcctgacgaaaggagagattaaaaaatggtttagtgacacaaggtacaaccagaga
aattcaaagagtaatcagtgcttacatctcaacaatgattcctctaccaccattattata
gactccagtgatgaaaccacggaatccccaactgttggtactgcacagcctaagcaatcc
tggaatccttttcctgactttactccccaaaagtttaaagagaaaactgcagagcagctt
cgtgtccttcaggcaagttttctcaacagctctgtacttacagatgaagaattaaatagg
ttaagggcacaaaccaaacttaccagaagagaaatcgatgcttggtttacagagaagaag
aaatcaaaagctttaaaggaagagaaaatggaaatagatgaaagtaatgcaggtagttcc
aaagaagaagctggagaaacttctcctgcagatgaatctggtgcacctaagtcagggagt
acaggcaagatatgtaaaaaaacacctgagcagctgcacatgcttaagagtgcatttgtc
cggacacagtggccatcaccagaagagtatgacaagttggccaaagaaagcgggcttgct
agaacagacatagttagttggtttggggacacccgttatgcttggaagaatggaaacttg
aaatggtactactactatcagagcgccaattcaagtagtatgaatggtctgtcttccctt
aggaaaagagggagagggagacccaaaggacggggaagaggaagaccgcgtgggcggcct
agaggaagcaaaagaattaacaactgggacaggggaccatcactcataaaatttaaaact
ggaactgcaatacttaaggattattacctgaagcacaagtttcttaatgagcaagacctt
gatgaacttgttaacaaatcacatatgggctatgagcaggtcagagagtggtttgcagaa
agacagagaagatcagaattaggtatagaattatttgaggaaaatgaggaggaagatgaa
gttattgatgaccaggaagaggatgaagaagaaacagatgatagtgacacttgggaacct
ccacgacatgtgaaacggaagctgtctaaatcagatgactga

DBGET integrated database retrieval system