KEGG   Homo sapiens (human): 11247
Entry
11247             CDS       T01001                                 
Symbol
NXPH4, NPH4
Name
(RefSeq) neurexophilin 4
  KO
K25711  neurexophilin-4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    11247 (NXPH4)
Cytokines and neuropeptides [BR:hsa04052]
 Neuropeptides
  Neuropeptides (Unclassified)
   11247 (NXPH4)
SSDB
Motif
Pfam: Neurexophilin
Other DBs
NCBI-GeneID: 11247
NCBI-ProteinID: NP_009155
OMIM: 604637
HGNC: 8078
Ensembl: ENSG00000182379
Position
12:57216794..57226449
AA seq 308 aa
MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQLPEPRSSDGLG
VGRAWSWAWPTNHTGALARAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKF
SLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPVPHPLQSTL
ALEGVLPGLGPPLGMAAAAAGPGLGGSLGGALAGPLGGALGVPGAKESRAFNCHVEYEKT
NRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIFVSFLSFDYKLVQKVCPDYNF
QSEHPYFG
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcggctgctcccggaatggttcctcttgctctttggcccgtggctccttaggaaggcc
gtcagtgcccagataccagagtccggaaggccgcagtacctggggctgcgccccgccgcg
gccggagcgggtgcccccggccagcagctcccagagccaaggtcttcggacggcctaggc
gtgggccgcgcctggagctgggcctggccgaccaaccacacgggggcgctggcccgggca
ggggcagccggggcgttgcccgcgcagcgcaccaagaggaagccgtccatcaaggcggcg
cgcgccaaaaagatcttcggctggggggacttctactttcgggtgcataccctcaagttt
tcgctgctggtgaccggcaagatcgtggaccatgtgaacggtaccttcagtgtgtatttc
cgccacaactcgtccagcctgggcaacctcagtgtcagcatcgtgccgccctccaagcgt
gtcgagttcggaggagtctggctgcccgggcctgtcccccaccctctgcagtctacgctc
gccctggagggggtgcttcctgggctggggcccccgctggggatggcagcagcagcggcg
gggcccgggcttgggggctccctcgggggcgcactggcggggccgcttgggggcgcgttg
ggagtgcctggggccaaagagtcacgcgctttcaattgccacgtggagtatgagaagaca
aaccgcgcgcgcaagcaccgaccgtgcctgtacgacccgtcgcaggtgtgcttcaccgag
cacacgcagagccaggccgcctggctctgtgccaagcccttcaaagtcatctgtatcttc
gtctctttcctcagctttgactacaaactggtgcagaaggtgtgcccagactataacttc
cagagtgagcacccctacttcggatag

DBGET integrated database retrieval system