KEGG   Homo sapiens (human): 11248
Entry
11248             CDS       T01001                                 
Symbol
NXPH3, NPH3
Name
(RefSeq) neurexophilin 3
  KO
K16658  neurexophilin-3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    11248 (NXPH3)
Cytokines and neuropeptides [BR:hsa04052]
 Neuropeptides
  Neuropeptides (Unclassified)
   11248 (NXPH3)
SSDB
Motif
Pfam: Neurexophilin
Other DBs
NCBI-GeneID: 11248
NCBI-ProteinID: NP_009156
OMIM: 604636
HGNC: 8077
Ensembl: ENSG00000182575
UniProt: O95157
Position
17:49575871..49583827
AA seq 252 aa
MQLTRCCFVFLVQGSLYLVICGQDDGPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPM
ANSTLLGLLAPPGEAWGILGQPPNRPNHSPPPSAKVKKIFGWGDFYSNIKTVALNLLVTG
KIVDHGNGTFSVHFQHNATGQGNISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWE
KVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFKVVCVYIAFYSTDYRLVQKVCPDY
NYHSDTPYYPSG
NT seq 759 nt   +upstreamnt  +downstreamnt
atgcaactgactcgctgctgcttcgtgttcctggtgcagggtagcctctatctggtcatc
tgtggccaggatgatggtcctcccggctcagaggaccctgagcgtgatgaccacgagggc
cagccccggccccgggtgcctcggaagcggggccacatctcacctaagtcccgccccatg
gccaattccactctcctagggctgctggccccgcctggggaggcttggggcattcttggg
cagccccccaaccgcccgaaccacagccccccaccctcagccaaggtgaagaaaatcttt
ggctggggcgacttctactccaacatcaagacggtggccctgaacctgctcgtcacaggg
aagattgtggaccatggcaatgggaccttcagcgtccacttccaacacaatgccacaggc
cagggaaacatctccatcagcctcgtgccccccagtaaagctgtagagttccaccaggaa
cagcagatcttcatcgaagccaaggcctccaaaatcttcaactgccggatggagtgggag
aaggtagaacggggccgccggacctcgctttgcacccacgacccagccaagatctgctcc
cgagaccacgctcagagctcagccacctggagctgctcccagcccttcaaagtcgtctgt
gtctacatcgccttctacagcacggactatcggctggtccagaaggtgtgcccagattac
aactaccatagtgataccccctactacccatctgggtga

DBGET integrated database retrieval system