KEGG   Homo sapiens (human): 11250Help
Entry
11250             CDS       T01001                                 

Gene name
GPR45, PSP24, PSP24(ALPHA), PSP24A
Definition
(RefSeq) G protein-coupled receptor 45
  KO
K08409  G protein-coupled receptor 45
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    11250 (GPR45)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    11250 (GPR45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 PLAC8
Motif
Other DBs
NCBI-GeneID: 11250
NCBI-ProteinID: NP_009158
OMIM: 604838
HGNC: 4503
Ensembl: ENSG00000135973
Vega: OTTHUMG00000130805
Pharos: Q9Y5Y3(Tbio)
UniProt: Q9Y5Y3 B5B0C1
Position
2q12.1
AA seq 372 aa AA seqDB search
MACNSTSLEAYTYLLLNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVY
QRPAMRSAINLLLATLAFSDIMLSLCCMPFTAVTLITVRWHFGDHFCRLSATLYWFFVLE
GVAILLIISVDRFLIIVQRQDKLNPRRAKVIIAVSWVLSFCIAGPSLTGWTLVEVPARAP
QCVLGYTELPADRAYVVTLVVAVFFAPFGVMLCAYMCILNTVRKNAVRVHNQSDSLDLRQ
LTRAGLRRLQRQQQVSVDLSFKTKAFTTILILFVGFSLCWLPHSVYSLLSVFSQRFYCGS
SFYATSTCVLWLSYLKSVFNPIVYCWRIKKFREACIELLPQTFQILPKVPERIRRRIQPS
TVYVCNENQSAV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcaacagcacgtcccttgaggcttacacatacctgctgctgaacaccagcaac
gcctcagactcggggtccacccagttgcccgcacccctcaggatctccttggccatagtg
atgctgctgatgaccgtggtggggttcctgggcaacactgtggtctgcatcatcgtgtac
cagaggccggctatgcgctcggccatcaacctgctgctggccaccctggccttctccgac
atcatgctgtccctctgctgcatgcccttcaccgccgtcaccctcatcaccgtgcgctgg
cactttggggaccacttctgccgcctctcagccacgctctactggttttttgtcctggag
ggcgtggccatcctgctcatcatcagcgtggaccgcttcctcatcatcgtccagcgccag
gacaagctgaacccgcgcagggccaaggtgatcatcgcggtctcctgggtgctgtccttc
tgcatcgcggggccctcgctcacgggctggacgctggtggaggtgccggcgcgggcccca
cagtgcgtgctgggctacacggagctccccgctgaccgcgcctacgtggtcaccttggtg
gtggccgtgttcttcgcgccctttggcgtcatgctgtgcgcctacatgtgcatcctcaac
acggtccgcaagaacgccgtgcgcgtgcacaaccagtcggacagcctggacctgcggcag
ctcaccagggcgggcctgcggcgcctgcagcggcagcaacaggtcagcgtggacttgagc
ttcaagaccaaggccttcaccaccatcctgatcctcttcgtgggcttctccctctgctgg
ctgccccactccgtctacagcctcctgtctgtgtttagccagcgcttttactgcggttcc
tccttctacgccaccagcacctgcgtcctgtggctcagttacctcaagtccgtcttcaac
cccatcgtctactgctggagaatcaaaaaattccgcgaggcctgcatagagttgctgccc
cagaccttccaaatcctccccaaagtgcctgagcggatccgaaggagaatccagccaagc
acagtctacgtgtgcaatgaaaaccagtctgcggtttag

DBGET integrated database retrieval system