KEGG   Homo sapiens (human): 11252
Entry
11252             CDS       T01001                                 

Gene name
PACSIN2, SDPII
Definition
(RefSeq) protein kinase C and casein kinase substrate in neurons 2
  KO
K20123  protein kinase C and casein kinase substrate in neurons protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11252 (PACSIN2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    11252 (PACSIN2)
SSDB
Motif
Pfam: FCH SH3_1 SH3_9 SH3_2 NPF DegS Tweety SH3BP5
Other DBs
NCBI-GeneID: 11252
NCBI-ProteinID: NP_001171899
OMIM: 604960
HGNC: 8571
Ensembl: ENSG00000100266
Vega: OTTHUMG00000150701
Pharos: Q9UNF0(Tbio)
UniProt: Q9UNF0
Structure
PDB: 
3ABH 3Q0K 3ACO 3HAJ

Position
22q13.2
AA seq 486 aa
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSS
YNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtctgtcacatatgatgattccgttggagtagaagtgtccagcgacagcttctgggag
gtcgggaactacaagcggactgtgaagcggatcgacgatggccaccgcctgtgcagcgac
ctcatgaactgcctgcatgagcgggcgcgcatcgagaaggcgtatgcgcagcagctcact
gagtgggcccggcgctggaggcagctcgtggagaaagggccccagtacgggaccgtggag
aaggcctggatggccttcatgtccgaggcagagagggtgagcgagctgcacctcgaggtg
aaggcctcactgatgaacgatgacttcgagaagatcaagaactggcagaaggaagccttt
cacaagcagatgatgggcggcttcaaggagaccaaggaagctgaggacggctttcggaag
gcacagaagccctgggccaagaagctgaaagaggtagaagcagcaaagaaagcccaccat
gcagcgtgcaaagaggagaagctggctatctcacgagaagccaacagcaaggcagaccca
tccctcaaccctgaacagctcaagaaattgcaagacaaaatagaaaagtgcaagcaagat
gttcttaagaccaaagagaagtatgagaagtccctgaaggaactcgaccagggcacaccc
cagtacatggagaacatggagcaggtgtttgagcagtgccagcagttcgaggagaaacgc
cttcgcttcttccgggaggttctgctggaggttcagaagcacctagacctgtccaatgtg
gctggctacaaagccatttaccatgacctggagcagagcatcagagcagctgatgcagtg
gaggacctgaggtggttccgagccaatcacgggccgggcatggccatgaactggccgcag
tttgaggagtggtccgcagacctgaatcgaaccctcagccggagagagaagaagaaggcc
actgacggcgtcaccctgacgggcatcaaccagacaggcgaccagtctctgccgagtaag
cccagcagcacccttaatgtcccgagcaaccccgcccagtctgcgcagtcacagtccagc
tacaaccccttcgaggatgaggacgacacgggcagcaccgtcagtgagaaggacgacact
aaggccaaaaatgtgagcagctacgagaagacccagagctatcccaccgactggtcagac
gatgagtctaacaaccccttctcctccacggatgccaatggggactcgaatccattcgac
gacgacgccacctcggggacggaagtgcgagtccgggccctgtatgactatgaggggcag
gagcatgatgagctgagcttcaaggctggggatgagctgaccaagatggaggacgaggat
gagcagggctggtgcaagggacgcttggacaacgggcaagttggcctatacccggcaaat
tatgtggaggcgatccagtga

DBGET integrated database retrieval system