KEGG   Homo sapiens (human): 11253Help
Entry
11253             CDS       T01001                                 

Gene name
MAN1B1, ERMAN1, ERManI, MANA-ER, MRT15
Definition
(RefSeq) mannosidase alpha class 1B member 1
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00073  N-glycan precursor trimming
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    11253 (MAN1B1)
   00513 Various types of N-glycan biosynthesis
    11253 (MAN1B1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    11253 (MAN1B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11253 (MAN1B1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     11253 (MAN1B1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    11253 (MAN1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_47
Motif
Other DBs
NCBI-GeneID: 11253
NCBI-ProteinID: NP_057303
OMIM: 604346
HGNC: 6823
Ensembl: ENSG00000177239
Vega: OTTHUMG00000020978
Pharos: Q9UKM7(Tchem)
UniProt: Q9UKM7
Structure
PDB: 

Position
9q34.3
AA seq 699 aa AA seqDB search
MAACEGRRSGALGSSQSDFLTPPVGGAPWAVATTVVMYPPPPPPPHRDFISVTLSFGENY
DNSKSWRRRSCWRKWKQLSRLQRNMILFLLAFLLFCGLLFYINLADHWKALAFRLEEEQK
MRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDG
TQEEATKRQEAPVDPRPEGDPQRTVISWRGAVIEPEQGTELPSRRAEVPTKPPLPPARTQ
GTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRSFSEWFGLGLTLIDALDTMWI
LGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSLFLRKAEDFGN
RLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEA
VEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQE
TQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHG
LPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPET
VESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFF
LGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctgcgagggcaggagaagcggagctctcggttcctctcagtcggacttcctg
acgccgccagtgggcggggccccttgggccgtcgccaccactgtagtcatgtacccaccg
ccgccgccgccgcctcatcgggacttcatctcggtgacgctgagctttggcgagaactat
gacaacagcaagagttggcggcggcgctcgtgctggaggaaatggaagcaactgtcgaga
ttgcagcggaatatgattctcttcctccttgcctttctgcttttctgtggactcctcttc
tacatcaacttggctgaccattggaaagctctggctttcaggctagaggaagagcagaag
atgaggccagaaattgctgggttaaaaccagcaaatccacccgtcttaccagctcctcag
aaggcggacaccgaccctgagaacttacctgagatttcgtcacagaagacacaaagacac
atccagcggggaccacctcacctgcagattagacccccaagccaagacctgaaggatggg
acccaggaggaggccacaaaaaggcaagaagcccctgtggatccccgcccggaaggagat
ccgcagaggacagtcatcagctggaggggagcggtgatcgagcctgagcagggcaccgag
ctcccttcaagaagagcagaagtgcccaccaagcctcccctgccaccggccaggacacag
ggcacaccagtgcatctgaactatcgccagaagggcgtgattgacgtcttcctgcatgca
tggaaaggataccgcaagtttgcatggggccatgacgagctgaagcctgtgtccaggtcc
ttcagtgagtggtttggcctcggtctcacactgatcgacgcgctggacaccatgtggatc
ttgggtctgaggaaagaatttgaggaagccaggaagtgggtgtcgaagaagttacacttt
gaaaaggacgtggacgtcaacctgtttgagagcacgatccgcatcctgggggggctcctg
agtgcctaccacctgtctggggacagcctcttcctgaggaaagctgaggattttggaaat
cggctaatgcctgccttcagaacaccatccaagattccttactcggatgtgaacatcggt
actggagttgcccacccgccacggtggacctccgacagcactgtggccgaggtgaccagc
attcagctggagttccgggagctctcccgtctcacaggggataagaagtttcaggaggca
gtggagaaggtgacacagcacatccacggcctgtctgggaagaaggatgggctggtgccc
atgttcatcaatacccacagtggcctcttcacccacctgggcgtattcacgctgggcgcc
agggccgacagctactatgagtacctgctgaagcagtggatccagggcgggaagcaggag
acacagctgctggaagactacgtggaagccatcgagggtgtcagaacgcacctgctgcgg
cactccgagcccagtaagctcacctttgtgggggagcttgcccacggccgcttcagtgcc
aagatggaccacctggtgtgcttcctgccagggacgctggctctgggcgtctaccacggc
ctgcccgccagccacatggagctggcccaggagctcatggagacttgttaccagatgaac
cggcagatggagacggggctgagtcccgagatcgtgcacttcaacctttacccccagccg
ggccgtcgggacgtggaggtcaagccagcagacaggcacaacctgctgcggccagagacc
gtggagagcctgttctacctgtaccgcgtcacaggggaccgcaaataccaggactggggc
tgggagattctgcagagcttcagccgattcacacgggtcccctcgggtggctattcttcc
atcaacaatgtccaggatcctcagaagcccgagcctagggacaagatggagagcttcttc
ctgggggagacgctcaagtatctgttcttgctcttctccgatgacccaaacctgctcagc
ctggatgcctacgtgttcaacaccgaagcccaccctctgcctatctggacccctgcctag

DBGET integrated database retrieval system