KEGG   Homo sapiens (human): 11254
Entry
11254             CDS       T01001                                 

Gene name
SLC6A14, BMIQ11
Definition
(RefSeq) solute carrier family 6 member 14
  KO
K05047  solute carrier family 6 (neurotransmitter transporter) member 14
Organism
hsa  Homo sapiens (human)
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    11254 (SLC6A14)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   11254 (SLC6A14)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 11254
NCBI-ProteinID: NP_009162
OMIM: 300444
HGNC: 11047
Ensembl: ENSG00000268104
Vega: OTTHUMG00000022245
Pharos: Q9UN76(Tbio)
UniProt: Q9UN76 B2R8J1
Position
Xq23
AA seq 642 aa
MDKLKCPSFFKCREKEKVSASSENFHVGENDENQDRGNWSKKSDYLLSMIGYAVGLGNVW
RFPYLTYSNGGGAFLIPYAIMLALAGLPLFFLECSLGQFASLGPVSVWRILPLFQGVGIT
MVLISIFVTIYYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNK
GIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLA
LCLLLAWLIVGAALFKGIKSSGKVVYFTALFPYVVLLILLVRGATLEGASKGISYYIGAQ
SNFTKLKEAEVWKDAATQIFYSLSVAWGGLVALSSYNKFKNNCFSDAIVVCLTNCLTSVF
AGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFWSILFFFMLLTLG
LDSQFASIETITTTIQDLFPKVMKKMRVPITLGCCLVLFLLGLVCVTQAGIYWVHLIDHF
CAGWGILIAAILELVGIIWIYGGNRFIEDTEMMIGAKRWIFWLWWRACWFVITPILLIAI
FIWSLVQFHRPNYGAIPYPDWGVALGWCMIVFCIIWIPIMAIIKIIQAKGNIFQRLISCC
RPASNWGPYLEQHRGERYKDMVDPKKEADHEIPTVSGSRKPE
NT seq 1929 nt   +upstreamnt  +downstreamnt
atggacaagttgaaatgcccgagtttcttcaagtgcagggagaaggagaaagtgtcggct
tcatcagagaatttccatgttggtgaaaatgatgagaatcaggaccgtggtaactggtcc
aaaaaatcggattatcttctatctatgattggatacgcagtgggattaggaaatgtgtgg
agatttccatatctgacctacagcaatggtggaggcgccttcttgataccttatgcaatt
atgttagcattggctggtttacctttgttctttctggagtgttcactgggacaatttgct
agcttaggtccagtttcagtttggaggattcttccattgtttcaaggtgtgggaattaca
atggtcctgatctccatttttgtgacaatctattacaatgtcataattgcctatagtctt
tactacatgtttgcttcttttcaaagtgaactaccatggaaaaattgttcttcgtggtca
gataaaaactgtagcagatcaccaatagtaactcactgtaatgtgagtacagtgaataaa
ggaatacaagagatcatccaaatgaataaaagctgggtagacatcaacaattttacctgc
atcaacggcagtgaaatttatcagccagggcagcttcccagtgaacaatattggaataaa
gtggcgctccaacggtcaagtggaatgaatgagactggagtaattgtttggtatttagca
ctttgtcttcttctggcttggctcatagttggagcagcactatttaaaggaatcaaatcg
tctggcaaggtggtatattttacagctcttttcccctatgtggtcctactcatcctgtta
gtacgaggtgcaactctggagggtgcttcaaaaggcatttcatactatattggagcccag
tcaaattttacaaaacttaaggaagctgaggtatggaaagatgctgccactcagatattt
tactccctttcagtggcttggggtggcttagttgctctatcatcttacaataagttcaaa
aacaactgcttctctgatgccattgtggtttgtttgacaaactgtctcactagcgtgttt
gctggatttgctattttttctatattgggacacatggcccatatatctggaaaggaagtt
tctcaagttgtaaaatcaggttttgatttggcattcattgcctatccagaggctctagcc
caactcccaggtggtccattttggtccatattattttttttcatgcttttaactttgggt
ctcgattctcagtttgcttcgattgaaacgatcacaacaacaattcaagatttatttccc
aaagtgatgaagaaaatgagggttcccataactttgggctgctgcttggttttgtttctc
cttggtctcgtctgtgtgactcaggctggaatttactgggttcatctgattgaccacttc
tgtgctggatggggcattttaattgcagctatactggagctagttggaatcatctggatt
tatggagggaacagattcattgaggatacagaaatgatgattggagcaaagaggtggata
ttctggctatggtggagagcttgctggtttgtaattacgcctatccttttgattgcaata
tttatctggtcattggtgcaatttcatagacctaattatggcgcaattccataccctgac
tggggagttgctttaggctggtgtatgattgttttctgcattatttggattccaattatg
gctatcataaaaataattcaggctaaaggaaacatctttcaacgccttataagttgctgc
agaccagcttctaactggggtccatacctggaacaacatcgtggggaaagatataaagac
atggtagatcctaaaaaagaggctgaccatgaaatacctactgttagtggcagcagaaaa
ccggaatga

DBGET integrated database retrieval system