KEGG   Homo sapiens (human): 11255Help
Entry
11255             CDS       T01001                                 

Gene name
HRH3, GPCR97, HH3R
Definition
(RefSeq) histamine receptor H3
  KO
K04151  histamine receptor H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Bavisant (DG02043): D09870 D09871
Betahistine (DG01004): D01592 D03102 D07522
Cipralisant maleate: D03518
Histamine: D08040
Histamine phosphate: D04445
Irdabisant (DG01330): D10128 D10129
Pitolisant (DG03021): D10749 D11490
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11255 (HRH3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    11255 (HRH3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    11255 (HRH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF3367 DUF621
Motif
Other DBs
NCBI-GeneID: 11255
NCBI-ProteinID: NP_009163
OMIM: 604525
HGNC: 5184
Ensembl: ENSG00000101180
Vega: OTTHUMG00000032899
Pharos: Q9Y5N1(Tclin)
UniProt: Q9Y5N1
Position
20q13.33
AA seq 445 aa AA seqDB search
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgccgcccgacgggccgctgaacgcttcgggggcgctggcgggcgaggcg
gcggcggcgggcggggcgcgcggcttctcggcagcctggaccgcggtgctggccgcgctc
atggcgctgctcatcgtggccacggtgctgggcaacgcgctggtcatgctcgccttcgtg
gccgactcgagcctccgcacccagaacaacttcttcctgctcaacctcgccatctccgac
ttcctcgtcggcgccttctgcatcccactgtatgtaccctacgtgctgacaggccgctgg
accttcggccggggcctctgcaagctgtggctggtagtggactacctgctgtgcacctcc
tctgccttcaacatcgtgctcatcagctacgaccgcttcctgtcggtcacccgagcggtc
tcataccgggcccagcagggtgacacgcggcgggcagtgcggaagatgctgctggtgtgg
gtgctggccttcctgctgtacggaccagccatcctgagctgggagtacctgtccgggggc
agctccatccccgagggccactgctatgccgagttcttctacaactggtacttcctcatc
acggcttccaccctggagttctttacgcccttcctcagcgtcaccttctttaacctcagc
atctacctgaacatccagaggcgcacccgcctccggctggatggggctcgagaggcagcc
ggccccgagccccctcccgaggcccagccctcaccacccccaccgcctggctgctggggc
tgctggcagaaggggcacggggaggccatgccgctgcacaggtatggggtgggtgaggcg
gccgtaggcgctgaggccggggaggcgaccctcgggggtggcggtgggggcggctccgtg
gcttcacccacctccagctccggcagctcctcgaggggcactgagaggccgcgctcactc
aagaggggctccaagccgtcggcgtcctcggcctcgctggagaagcgcatgaagatggtg
tcccagagcttcacccagcgctttcggctgtctcgggacaggaaagtggccaagtcgctg
gccgtcatcgtgagcatctttgggctctgctgggccccatacacgctgctgatgatcatc
cgggccgcctgccatggccactgcgtccctgactactggtacgaaacctccttctggctc
ctgtgggccaactcggctgtcaaccctgtcctctaccctctgtgccaccacagcttccgc
cgggccttcaccaagctgctctgcccccagaagctcaaaatccagccccacagctccctg
gagcactgctggaagtga

DBGET integrated database retrieval system