KEGG   Homo sapiens (human): 11261Help
Entry
11261             CDS       T01001                                 

Gene name
CHP1, CHP, SLC9A1BP, Sid470p, p22, p24
Definition
(RefSeq) calcineurin like EF-hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
hsa  Homo sapiens (human)
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    11261 (CHP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     11261 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 11261
NCBI-ProteinID: NP_009167
OMIM: 606988
HGNC: 17433
Ensembl: ENSG00000187446
Vega: OTTHUMG00000130233
Pharos: Q99653(Tbio)
UniProt: Q99653 A0A024R9M9
Structure
PDB: 

Position
15q15.1
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
accggcttttcccacagtcaaatcactcgcctctacagccggttcaccagcctggacaaa
ggagagaatgggactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttctttccagagggagaggaccaggtaaacttc
cgtggattcatgcgaactttggctcatttccgccccattgaggataatgaaaagagcaaa
gatgtgaatggacccgaaccactcaacagccgaagcaacaaactgcactttgcttttcga
ctatatgatttggataaagatgaaaagatctcccgtgatgagctgttacaggtgctacgc
atgatggtcggagtaaatatctcagatgagcagctgggcagcatcgcagacaggaccatt
caggaggctgatcaggatggggacagtgccatatctttcacagaatttgttaaggttttg
gagaaggtggatgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system