KEGG   Homo sapiens (human): 11273Help
Entry
11273             CDS       T01001                                 

Gene name
ATXN2L, A2D, A2LG, A2LP, A2RP
Definition
(RefSeq) ataxin 2 like
  KO
K23625  ataxin 2/2L
Organism
hsa  Homo sapiens (human)
Pathway
hsa05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    11273 (ATXN2L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    11273 (ATXN2L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     11273 (ATXN2L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SM-ATX LsmAD PAM2 LSM14
Motif
Other DBs
NCBI-GeneID: 11273
NCBI-ProteinID: NP_009176
OMIM: 607931
HGNC: 31326
Ensembl: ENSG00000168488
Vega: OTTHUMG00000097038
Pharos: Q8WWM7(Tbio)
UniProt: Q8WWM7
Position
16p11.2
AA seq 1075 aa AA seqDB search
MLKPQPLQQPSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLG
PVAAAGSGLRRGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQSPVFEGVYNN
SRMLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIV
DTMVFKPSDVMLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDD
YDLESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLA
REIESSPQYRLRIAMENDDGRTEEEKHSAVQRQGSGRESPSLASREGKYIPLPQRVREGP
RGGVRCSSSRGGRPGLSSLPPRGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGAK
TLSSPSNRPSGETSVPPPPAVGRMYPPRSPKSAAPAPISASCPEPPIGSAVPTSSASIPV
TSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRF
QLEELRKFGAQFKLQPSSSPENSLDPFPPRILKEEPKGKEKEVDGLLTSEPMGSPVSSKT
ESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGEDKDEGPVAEQVKKSTLN
PNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQYISYIPQIHMG
PAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAGPPLVA
ATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTP
QYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQHQAGQ
APHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNM
AHVTQAHVQTGITAAPPPHPGAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSP
YPYIGHPQGEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcctcagccgctacaacagccctcccagccccagcagccgccccccacgcaa
caggccgtggcccgtcggccccccgggggcaccagccctcccaacggcggcctcccgggg
ccgctggccacctctgcggctcctcccgggcctccagcggccgcctccccctgcctgggg
cctgtggccgctgccgggagcgggctccgccggggagccgaaggcatcttggcgccgcag
ccgccgccgccgcagcaacaccaggagaggccgggggcagccgccatcggcagcgccagg
ggacagagcacaggaaagggacccccacagtcacctgtgtttgaaggcgtctacaacaat
tccagaatgctgcatttccttacagctgttgtgggctccacttgtgatgtaaaggtgaaa
aatggtaccacttatgagggtatcttcaagacgctaagctcaaagtttgaactagccgtg
gatgctgtgcaccggaaagcatctgagccagcaggtggccctcgtcgggaggacattgtg
gacaccatggtgtttaagccaagtgatgtcatgcttgttcacttccgaaatgttgacttc
aactatgctactaaagacaagttcaccgattcagccattgccatgaactcgaaagtgaat
ggggaacacaaagagaaggtgcttcagcgctgggaggggggtgacagcaacagcgacgac
tatgacctcgagtctgacatgtccaatggatgggaccccaatgaaatgttcaagttcaat
gaggagaactacggtgtgaagactacctatgatagcagtctttcttcttatacggtgccc
ttagaaaaggacaactcagaagagtttcgtcagcgagagctgcgtgcggcccagttggct
cgagagattgaatcaagcccccagtaccgcctacggatcgccatggagaacgacgatggg
cgcactgaagaggagaagcacagtgcagtccagcggcagggctcagggcgggagagcccc
agcttggcatccagggaggggaagtatatccctctgcctcaacgagtccgggaaggtccc
cggggaggagttcgatgcagcagctctcggggcggtcggcctggccttagctctttgcca
cctcgtggccctcaccatctggacaacagcagccctggcccaggttctgaggcccgtggt
atcaatggaggcccttcccgcatgtccccaaaggcacagcggcctctgagaggtgccaag
actctgtcttcgcccagtaataggccttctggagaaacttctgttccacctcctcctgca
gtgggccggatgtatcccccgcgttctcccaagtctgctgcccctgccccaatctcagct
tcctgtccagagcctcccatcggctcggcagtgccaacctcttcagcctccatccctgtg
acctcatcagtctcagatcctggagtgggctccatttctccagcttctccaaagatctcc
ctggcccccacagatgtaaaagaactctctaccaaggaacctgggagaactctggagccc
caggagctggctcggatagctgggaaagtccctggtcttcagaatgaacagaaacgattc
caactggaagaactgagaaagtttggggcccagtttaagcttcagcccagtagctcccct
gagaacagcctggatccttttcctccccggatcttaaaggaggagcccaaaggaaaggag
aaagaggttgatggtctgttgacttcagagcccatggggtctcccgtctcctccaagaca
gagtccgtatcggataaggaggacaaaccacccctggcaccatcaggaggcactgagggg
ccagagcagcccccaccaccttgtccaagccaaactggcagccccccggtgggcctcatc
aagggagaagacaaagatgagggccctgttgctgaacaagtaaagaaatcaacgttgaac
cctaatgctaaggagttcaatcctacaaagcctctgctgtctgtgaataaatccaccagt
accccaacttctccggggccccggactcattcaactccctccatcccggtgctgacagca
ggccagagtgggctatacagcccccagtacatctcctacatacctcagatccacatggga
ccagctgtgcaggcacctcagatgtatccatatcctgtatccaattcagtgcctgggcag
cagggcaagtaccggggagcaaaaggctcccttcctccgcagcgctcggaccaacaccag
ccagcctcagccccgccgatgatgcaggccgccgcggctgctggcccgcctctggtggct
gccacgccctattcttcctacatcccctacaaccctcagcagttcccaggccagccagcc
atgatgcagcccatggcccactacccctcacagccggtgtttgcccccatgcttcagagc
aacccacgcatgctgacgtcgggcagccatccccaggccatcgtgtcatcctctacccct
cagtacccttctgcagagcagcctaccccccaagccctttatgccactgttcaccagtcc
tacccacaccatgccacacagctccatgcccaccagccgcagccggctaccacgcctact
ggaagccagccgcagtcccagcatgcggcccccagtcctgtccagcatcaggcggggcag
gccccacacttgggcagtggacagccacagcagaatctgtaccacccaggggccctgaca
ggcacgccgccctctctgccaccgggaccttctgcccagtcccctcagagcagcttcccc
cagccagccgctgtgtatgccatccaccaccagcagctgccccacggcttcaccaacatg
gcccatgttacccaggcccatgtccaaactggaatcacagcagccccgccccctcaccct
ggggctccccacccgccccaggtgatgctgctgcacccaccccagagtcatggggggccc
ccccaaggcgcggtgccccagagtggggtgcctgcactctcagcttccacaccctcaccc
tacccctacatcggacacccccaaggtgagcagcctggccaggcgcctggatttccagga
ggagccgatgacaggattcgtgagttctcattagctgggggaatttggcatggaagagct
gaggggctgcaggtggggcaggatgcacgggttctgggtggggagtga

DBGET integrated database retrieval system