KEGG   Homo sapiens (human): 112744
Entry
112744            CDS       T01001                                 

Gene name
IL17F, CANDF6, IL-17F, ML-1, ML1
Definition
(RefSeq) interleukin 17F
  KO
K05494  interleukin 17F
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease
Disease
H01109  Chronic mucocutaneous candidiasis
Drug target
Afasevikumab: D10902
Bimekizumab: D11550
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112744 (IL17F)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112744 (IL17F)
   04657 IL-17 signaling pathway
    112744 (IL17F)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    112744 (IL17F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    112744 (IL17F)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   112744 (IL17F)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 112744
NCBI-ProteinID: NP_443104
OMIM: 606496
HGNC: 16404
Ensembl: ENSG00000112116
Vega: OTTHUMG00000014845
Pharos: Q96PD4(Tbio)
UniProt: Q96PD4
Structure
PDB: 
5N92 1JPY 5NAN 3JVF

Position
6p12.2
AA seq 163 aa
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIG
IINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNS
VPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacagtgaagaccctgcatggcccagccatggtcaagtacttgctgctgtcgatattg
gggcttgcctttctgagtgaggcggcagctcggaaaatccccaaagtaggacatactttt
ttccaaaagcctgagagttgcccgcctgtgccaggaggtagtatgaagcttgacattggc
atcatcaatgaaaaccagcgcgtttccatgtcacgtaacatcgagagccgctccacctcc
ccctggaattacactgtcacttgggaccccaaccggtacccctcggaagttgtacaggcc
cagtgtaggaacttgggctgcatcaatgctcaaggaaaggaagacatctccatgaattcc
gttcccatccagcaagagaccctggtcgtccggaggaagcaccaaggctgctctgtttct
ttccagttggagaaggtgctggtgactgttggctgcacctgcgtcacccctgtcatccac
catgtgcagtaa

DBGET integrated database retrieval system