KEGG   Homo sapiens (human): 112755Help
Entry
112755            CDS       T01001                                 

Gene name
STX1B, GEFSP9, STX1B1, STX1B2
Definition
(RefSeq) syntaxin 1B
  KO
K08486  syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
Disease
H00783  Febrile seizures
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    112755 (STX1B)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    112755 (STX1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    112755 (STX1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    112755 (STX1B)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    112755 (STX1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   112755 (STX1B)
  Exosomal proteins of other body fluids (saliva and urine)
   112755 (STX1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 Lzipper-MIP1 GNVR FAD_binding_1 DUF1910 RE_NgoFVII Baculo_PEP_C Acyl-CoA_dh_2 TolA_bind_tri Sec34
Motif
Other DBs
NCBI-GeneID: 112755
NCBI-ProteinID: NP_443106
OMIM: 601485
HGNC: 18539
Ensembl: ENSG00000099365
Vega: OTTHUMG00000132391
Pharos: P61266(Tbio)
UniProt: P61266
Position
16p11.2
AA seq 288 aa AA seqDB search
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAI
LAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDI
KMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSV
DYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcggactcaagagctgcggagtgcgaaagacagtgatgatgaagaggaggtg
gtccacgtggatcgggaccacttcatggatgagttctttgaacaggtggaagagatccgg
ggctgcattgagaaactgtcggaggatgtggagcaggtgaaaaaacagcatagcgccatc
ctggccgcacccaacccagatgagaagaccaaacaggagctggaggatctcactgcagac
atcaagaagacggccaacaaggttcggtccaaattgaaagcgatcgagcaaagcattgaa
caggaggaggggctgaaccgttcctccgcggacctgcgcatccgcaagacccagcactcc
acactgtcccggaagttcgtggaggtaatgaccgaatataacgcgacccagtccaagtac
cgggaccgctgcaaggaccggatccagcggcaactggagatcactggaaggaccaccacc
aacgaagaactggaagacatgctggagagcgggaagctggccatcttcacagatgacatc
aaaatggactcacagatgacgaagcaggcgctgaatgagattgagacgaggcacaatgag
atcatcaagctggagaccagcatccgcgagctgcacgatatgtttgtggacatggccatg
ctcgtagagagccagggagagatgattgaccgcatcgagtacaacgtggaacattctgtg
gactacgtggagcgagctgtgtctgacaccaagaaagcagtgaaatatcagagcaaggcc
cggaggaagaaaatcatgatcatcatttgctgtgtggtgctgggggtggtcttggcgtca
tccattggggggacgctgggcttgtag

DBGET integrated database retrieval system