KEGG   Homo sapiens (human): 112755
Entry
112755            CDS       T01001                                 

Gene name
STX1B, GEFSP9, STX1B1, STX1B2
Definition
(RefSeq) syntaxin 1B
  KO
K08486  syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
Disease
H00783  Febrile seizures
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    112755 (STX1B)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    112755 (STX1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    112755 (STX1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    112755 (STX1B)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    112755 (STX1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   112755 (STX1B)
  Exosomal proteins of other body fluids (saliva and urine)
   112755 (STX1B)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 Lzipper-MIP1 GNVR FAD_binding_1 Baculo_PEP_C Acyl-CoA_dh_2 DUF1910 TolA_bind_tri CHDCT2 Sec34
Other DBs
NCBI-GeneID: 112755
NCBI-ProteinID: NP_443106
OMIM: 601485
HGNC: 18539
Ensembl: ENSG00000099365
Vega: OTTHUMG00000132391
Pharos: P61266(Tbio)
UniProt: P61266
Position
16p11.2
AA seq 288 aa
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAI
LAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDI
KMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSV
DYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggatcggactcaagagctgcggagtgcgaaagacagtgatgatgaagaggaggtg
gtccacgtggatcgggaccacttcatggatgagttctttgaacaggtggaagagatccgg
ggctgcattgagaaactgtcggaggatgtggagcaggtgaaaaaacagcatagcgccatc
ctggccgcacccaacccagatgagaagaccaaacaggagctggaggatctcactgcagac
atcaagaagacggccaacaaggttcggtccaaattgaaagcgatcgagcaaagcattgaa
caggaggaggggctgaaccgttcctccgcggacctgcgcatccgcaagacccagcactcc
acactgtcccggaagttcgtggaggtaatgaccgaatataacgcgacccagtccaagtac
cgggaccgctgcaaggaccggatccagcggcaactggagatcactggaaggaccaccacc
aacgaagaactggaagacatgctggagagcgggaagctggccatcttcacagatgacatc
aaaatggactcacagatgacgaagcaggcgctgaatgagattgagacgaggcacaatgag
atcatcaagctggagaccagcatccgcgagctgcacgatatgtttgtggacatggccatg
ctcgtagagagccagggagagatgattgaccgcatcgagtacaacgtggaacattctgtg
gactacgtggagcgagctgtgtctgacaccaagaaagcagtgaaatatcagagcaaggcc
cggaggaagaaaatcatgatcatcatttgctgtgtggtgctgggggtggtcttggcgtca
tccattggggggacgctgggcttgtag

KEGG   Homo sapiens (human): 2054
Entry
2054              CDS       T01001                                 

Gene name
STX2, EPIM, EPM, STX2A, STX2B, STX2C
Definition
(RefSeq) syntaxin 2
  KO
K08486  syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    2054 (STX2)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    2054 (STX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2054 (STX2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2054 (STX2)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    2054 (STX2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   2054 (STX2)
  Exosomal proteins of other body fluids (saliva and urine)
   2054 (STX2)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 DUF3671 Prominin Syntaxin-6_N Branch DUF1640 DUF16 ApoLp-III T2SSF YnfE DUF2207 YtxH DUF5655 DUF2205 ISG65-75 LMBR1 Med28 CbiA
Other DBs
NCBI-GeneID: 2054
NCBI-ProteinID: NP_919337
OMIM: 132350
HGNC: 3403
Ensembl: ENSG00000111450
Vega: OTTHUMG00000168365
Pharos: P32856(Tbio)
UniProt: P32856
Position
12q24.33
AA seq 288 aa
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSII
LSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS
VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDI
ISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT
DYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcgggaccggctgccagacctgacggcgtgtaggaagaatgatgatggagacacagtt
gttgtggttgagaaagatcatttcatggatgatttcttccatcaggtggaggagattaga
aacagtattgataaaataactcaatatgttgaagaagtaaagaaaaaccacagcatcatt
ctttctgcaccaaacccggaaggaaaaataaaagaagagcttgaagatctgaacaaagaa
atcaagaaaactgcgaataaaattcgagccaagttaaaggctattgaacaaagttttgat
caggatgagagtgggaaccggacttcagtggatcttcggatacgaagaacccagcattcg
gtgctgtctcggaagtttgtggaagccatggcggagtacaatgaggcacagactctgttt
cgggagcggagcaaaggccgcatccagcgccagctggagataactgggagaaccaccaca
gacgacgagctagaagagatgctggagagcgggaagccatccatcttcacttccgacatt
atatcagattcacaaattactagacaagctctcaatgaaatcgagtcacgtcacaaggac
atcatgaagctggagaccagcatccgagagttgcatgagatgttcatggacatggctatg
tttgtggagactcagggtgaaatgatcaacaacatagaaagaaatgttatgaatgccaca
gactatgtagaacacgctaaagaagaaacaaaaaaagctatcaaatatcagagcaaggca
agaaggaaaaagtggataattattgctgtgtcagtggttctggttgccataatcgctcta
attattggcttgtcagttggcaaatga

KEGG   Homo sapiens (human): 6804
Entry
6804              CDS       T01001                                 

Gene name
STX1A, HPC-1, P35-1, STX1, SYN1A
Definition
(RefSeq) syntaxin 1A
  KO
K04560  syntaxin 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
hsa04911  Insulin secretion
hsa05016  Huntington disease
hsa05031  Amphetamine addiction
Network
nt06410  Calcium signaling
nt06461  Huntington disease
  Element
N00986  Mutation-caused aberrant Htt to VGCC-Ca2+ -apoptotic pathway
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6804 (STX1A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    6804 (STX1A)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    6804 (STX1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    6804 (STX1A)
  09165 Substance dependence
   05031 Amphetamine addiction
    6804 (STX1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6804 (STX1A)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    6804 (STX1A)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Ferritin GNVR PspA_IM30 Prominin Syntaxin-6_N Laminin_II DUF1910 FAD_binding_1 SIMPL Lzipper-MIP1 FlgN EcoEI_R_C DUF148 ETRAMP CHDCT2 Lipoprotein_2 Med9 ALIX_LYPXL_bnd
Other DBs
NCBI-GeneID: 6804
NCBI-ProteinID: NP_004594
OMIM: 186590
HGNC: 11433
Ensembl: ENSG00000106089
Vega: OTTHUMG00000137422
Pharos: Q16623(Tbio)
UniProt: Q16623 Q75ME0
Position
7q11.23
AA seq 288 aa
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgatgatgatgatgtc
gctgtcaccgtggaccgagaccgcttcatggatgagttctttgagcaggtggaggagatt
cgaggcttcattgacaagatcgcagagaacgtggaggaggtgaagcggaagcacagtgcc
atcctggcatcccccaaccccgatgagaagacgaaggaggagctggaagaactcatgtcc
gacataaagaagacagcaaacaaagttcgttccaagttaaagagcatcgagcagtccatc
gagcaagaggaaggcctgaaccgctcctccgctgacctgaggatccggaagacacagcac
tccacgctgtccagaaagtttgtggaggtcatgtcggagtacaacgccacgcagtccgac
taccgcgagcgctgcaaaggccgcatccagaggcagctggagatcaccggcaggaccacg
accagtgaggagctggaggacatgctggagagtgggaaccccgccatctttgcctctggg
atcatcatggactccagcatctcgaagcaggctctgagcgagattgagacgcggcacagt
gagatcatcaagctggagaacagcatccgtgagctacacgacatgttcatggacatggcc
atgctcgtggagagccagggagagatgattgacaggatcgagtacaatgtggaacacgcg
gtagactatgtggagagggccgtgtctgacaccaagaaggccgtcaagtaccagagcaag
gcgcgccggaagaaaatcatgatcatcatctgctgtgtgatcctgggcatcgtcatcgcc
tccactgttgggggcatcttcgcctag

KEGG   Homo sapiens (human): 6809
Entry
6809              CDS       T01001                                 

Gene name
STX3, STX3A
Definition
(RefSeq) syntaxin 3
  KO
K08486  syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6809 (STX3)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    6809 (STX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6809 (STX3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6809 (STX3)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    6809 (STX3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   6809 (STX3)
  Exosomal proteins of other body fluids (saliva and urine)
   6809 (STX3)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Branch GyrB_insert SIMPL DUF3040 Prominin T2SSF RP-C_C
Other DBs
NCBI-GeneID: 6809
NCBI-ProteinID: NP_004168
OMIM: 600876
HGNC: 11438
Ensembl: ENSG00000166900
Vega: OTTHUMG00000167353
Pharos: Q13277(Tbio)
UniProt: Q13277 Q53YE2
Position
11q12.1
AA seq 289 aa
MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLY
SIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQH
SVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSG
IIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTV
DHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILALIIGLSVGLN
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaaggaccgtctggagcagctgaaggccaagcagctgacacaggatgatgatactgat
gcggttgagattgctatcgacaacacggcttttatggacgagttcttttctgagattgag
gaaactcggcttaacattgacaagatctcagaacatgtagaggaggctaagaaactctac
agtatcattctctctgcaccgattccagagccaaaaaccaaggatgacctagagcagctc
acgactgagattaagaaaagggccaacaacgtccggaacaaactgaagagcatggagaag
catattgaagaagatgaggtcaggtcatcggcagaccttcggattcggaaatcccagcac
tctgtcctttctcggaagtttgtggaggtgatgaccaaatacaatgaagctcaagtggac
ttccgagaacgcagcaaagggcgaatccagcggcagctcgaaattactggcaaaaagaca
accgatgaggagctggaggagatgttggagagtggcaacccggccatcttcacttctggg
atcattgactcacagatttccaagcaagccctcagtgagattgagggacgacacaaggac
attgtgaggctggagagcagcatcaaggagcttcacgacatgtttatggacatcgccatg
ctggtggagaatcagggtgagatgttagataacatagagttgaatgtcatgcacacagtg
gaccacgtggagaaggcacgagatgaaacgaaaaaagctgtgaaataccagagtcaggcc
cggaagaaattgataattatcattgtgctagtagttgtgttgctgggcattttagcattg
attattggactttccgttgggctgaattaa

DBGET integrated database retrieval system