KEGG   Homo sapiens (human): 11280Help
Entry
11280             CDS       T01001                                 

Gene name
SCN11A, FEPS3, HSAN7, NAV1.9, NaN, PN5, SCN12A, SNS-2
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 11
  KO
K04843  voltage-gated sodium channel type XI alpha
Organism
hsa  Homo sapiens (human)
Disease
H00265  Hereditary sensory and autonomic neuropathy
H01391  Familial episodic pain syndrome
Drug target
Actisomide: D02762
Ajmaline: D00199
Aminobenzoic acid (DG00379): D02456 D02906 D02907
Amiodarone (DG00204): D00636 D02910
Aprindine (DG00199): D01326 D02969
Articaine (DG00805): D02991 D07468
Benzocaine: D00552
Bupivacaine (DG00801): D01450 D07552
Carbamazepine: D00252
Chloroprocaine (DG00800): D00732 D07678
Cibenzoline (DG00209): D01455 D03492
Cinchocaine (DG00297): D00733 D02220
Cocaine (DG00808): D00110 D02182
Disopyramide (DG00194): D00303 D00637
Eleclazine: D11155
Encainide (DG00203): D03991 D07894
Eslicarbazepine (DG00848): D09215 D09612
Ethyl piperidinoacetylaminobenzoate: D01519
Flecainide (DG00201): D00638 D07962
Fosphenytoin (DG00847): D02096 D07595 D07993
Indecainide hydrochloride: D04521
Lamotrigine: D00354
Levobupivacaine (DG00807): D01287 D08116
Levosemotiadil fumarate: D09833
Lidocaine (DG00196): D00358 D02086 D08127
Lorajmine: D04774
Mephenytoin: D00375
Mepivacaine (DG00802): D00738 D08181
Mexiletine (DG00197): D00639 D08215
Oxcarbazepine: D00533
Oxetacaine (DG00299): D01152 D08311
Oxybuprocaine (DG00392): D01768 D08319
Phenytoin (DG00846): D00512 D02103
Pilsicainide (DG01257): D01554 D08377
Pirmenol (DG01381): D01785 D06517 D08394
Pramocaine (DG00300): D00739 D08407
Prilocaine (DG00803): D00553 D01243
Procainamide (DG00193): D00477 D08421
Procaine (DG00298): D00740 D08422
Propafenone (DG00200): D00640 D08435
Proxymetacaine (DG01145): D02098 D08448
Quinidine (DG00192): D00642 D00643 D02272 D08458 D08459
Recainam (DG01421): D05708 D05709
Ropivacaine (DG00806): D04048 D08490
Rufinamide: D05775
Sparteine (DG00195): D01041 D02239
Tetracaine (DG00296): D00551 D00741
Tocainide (DG00198): D02088 D06172
Topiramate: D00537
Transcainide: D06203
Zonisamide: D00538
p-Butylaminobenzoyldiethylaminoethyl hydrochloride: D01967
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    11280 (SCN11A)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   11280 (SCN11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Na_trans_assoc PKD_channel GPHH
Motif
Other DBs
NCBI-GeneID: 11280
NCBI-ProteinID: NP_054858
OMIM: 604385
HGNC: 10583
Ensembl: ENSG00000168356
Vega: OTTHUMG00000048246
Pharos: Q9UI33(Tclin)
UniProt: Q9UI33
Position
3p22.2
AA seq 1791 aa AA seqDB search
MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKKSKDQTGEVPQPRPQLDLKASR
KLPKLYGDIPRELIGKPLEDLDPFYRNHKTFMVLNRKRTIYRFSAKHALFIFGPFNSIRS
LAIRVSVHSLFSMFIIGTVIINCVFMATGPAKNSNSNNTDIAECVFTGIYIFEALIKILA
RGFILDEFSFLRDPWNWLDSIVIGIAIVSYIPGITIKLLPLRTFRVFRALKAISVVSRLK
VIVGALLRSVKKLVNVIILTFFCLSIFALVGQQLFMGSLNLKCISRDCKNISNPEAYDHC
FEKKENSPEFKMCGIWMGNSACSIQYECKHTKINPDYNYTNFDNFGWSFLAMFRLMTQDS
WEKLYQQTLRTTGLYSVFFFIVVIFLGSFYLINLTLAVVTMAYEEQNKNVAAEIEAKEKM
FQEAQQLLKEEKEALVAMGIDRSSLTSLETSYFTPKKRKLFGNKKRKSFFLRESGKDQPP
GSDSDEDCQKKPQLLEQTKRLSQNLSLDHFDEHGDPLQRQRALSAVSILTITMKEQEKSQ
EPCLPCGENLASKYLVWNCCPQWLCVKKVLRTVMTDPFTELAITICIIINTVFLAMEHHK
MEASFEKMLNIGNLVFTSIFIAEMCLKIIALDPYHYFRRGWNIFDSIVALLSFADVMNCV
LQKRSWPFLRSFRVLRVFKLAKSWPTLNTLIKIIGNSVGALGSLTVVLVIVIFIFSVVGM
QLFGRSFNSQKSPKLCNPTGPTVSCLRHWHMGDFWHSFLVVFRILCGEWIENMWECMQEA
NASSSLCVIVFILITVIGKLVVLNLFIALLLNSFSNEERNGNLEGEARKTKVQLALDRFR
RAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVMEMKRGSETQEELGIL
TSVPKTLGVRHDWTWLAPLAEEEDDVEFSGEDNAQRITQPEPEQQAYELHQENKKPTSQR
VQSVEIDMFSEDEPHLTIQDPRKKSDVTSILSECSTIDLQDGFGWLPEMVPKKQPERCLP
KGFGCCFPCCSVDKRKPPWVIWWNLRKTCYQIVKHSWFESFIIFVILLSSGALIFEDVHL
ENQPKIQELLNCTDIIFTHIFILEMVLKWVAFGFGKYFTSAWCCLDFIIVIVSVTTLINL
MELKSFRTLRALRPLRALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLVFCILGVYFF
SGKFGKCINGTDSVINYTIITNKSQCESGNFSWINQKVNFDNVGNAYLALLQVATFKGWM
DIIYAAVDSTEKEQQPEFESNSLGYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQQKKLGG
QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKCQGLVFDIVTSQIFDIIIISLIILNM
ISMMAESYNQPKAMKSILDHLNWVFVVIFTLECLIKIFALRQYYFTNGWNLFDCVVVLLS
IVSTMISTLENQEHIPFPPTLFRIVRLARIGRILRLVRAARGIRTLLFALMMSLPSLFNI
GLLLFLIMFIYAILGMNWFSKVNPESGIDDIFNFKTFASSMLCLFQISTSAGWDSLLSPM
LRSKESCNSSSENCHLPGIATSYFVSYIIISFLIVVNMYIAVILENFNTATEESEDPLGE
DDFDIFYEVWEKFDPEATQFIKYSALSDFADALPEPLRVAKPNKYQFLVMDLPMVSEDRL
HCMDILFAFTARVLGGSDGLDSMKAMMEEKFMEANPLKKLYEPIVTTTKRKEEERGAAII
QKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
NT seq 5376 nt NT seq  +upstreamnt  +downstreamnt
atggatgacagatgctacccagtaatctttccagatgagcggaatttccgccccttcact
tccgactctctggctgcaattgagaagcggattgccatccaaaaggagaaaaagaagtct
aaagaccagacaggagaagtaccccagcctcggcctcagcttgacctaaaggcctccagg
aagttgcccaagctctatggcgacattcctcgtgagctcataggaaagcctctggaagac
ttggacccattctaccgaaatcataagacatttatggtgttaaacagaaagaggacaatc
taccgcttcagtgccaagcatgccttgttcatttttgggcctttcaattcaatcagaagt
ttagccattagagtctcagtccattcattgttcagcatgttcattatcggcaccgttatc
atcaactgcgtgttcatggctacagggcctgctaaaaacagcaacagtaacaatactgac
attgcagagtgtgtcttcactgggatttatatttttgaagctttgattaaaatattggca
agaggtttcattctggatgagttttctttccttcgagatccatggaactggctggactcc
attgtcattggaatagcgattgtgtcatatattccaggaatcaccatcaaactattgccc
ctgcgtaccttccgtgtgttcagagctttgaaagcaatttcagtagtttcacgtctgaag
gtcatcgtgggggccttgctacgctctgtgaagaagctggtcaacgtgattatcctcacc
ttcttttgcctcagcatctttgccctggtaggtcagcagctcttcatgggaagtctgaac
ctgaaatgcatctcgagggactgtaaaaatatcagtaacccggaagcttatgaccattgc
tttgaaaagaaagaaaattcacctgaattcaaaatgtgtggcatctggatgggtaacagt
gcctgttccatacaatatgaatgtaagcacaccaaaattaatcctgactataattatacg
aattttgacaactttggctggtcttttcttgccatgttccggctgatgacccaagattcc
tgggagaagctttatcaacagaccctgcgtactactgggctctactcagtcttcttcttc
attgtggtcattttcctgggctccttctacctgattaacttaaccctggctgttgttacc
atggcatatgaggagcagaacaagaatgtagctgcagagatagaggccaaggaaaagatg
tttcaggaagcccagcagctgttaaaggaggaaaaggaggctctggttgccatgggaatt
gacagaagttcacttacttcccttgaaacatcatattttaccccaaaaaagagaaagctc
tttggtaataagaaaaggaagtccttctttttgagagagtctgggaaagaccagcctcct
gggtcagattctgatgaagattgccaaaaaaagccacagctcctagagcaaaccaaacga
ctgtcccagaatctatcactggaccactttgatgagcatggagatcctctccaaaggcag
agagcactgagtgctgtcagcatcctcaccatcaccatgaaggaacaagaaaaatcacaa
gagccttgtctcccttgtggagaaaacctggcatccaagtacctcgtgtggaactgttgc
ccccagtggctgtgcgttaagaaggtcctgagaactgtgatgactgacccgtttactgag
ctggccatcaccatctgcatcatcatcaacactgtcttcttggccatggagcatcacaag
atggaggccagttttgagaagatgttgaatatagggaatttggttttcactagcattttt
atagcagaaatgtgcctaaaaatcattgcgctcgatccctaccactactttcgccgaggc
tggaacatttttgacagcattgttgctcttctgagttttgcagatgtaatgaactgtgta
cttcaaaagagaagctggccattcttgcgttccttcagagtgctcagggtcttcaagtta
gccaaatcctggccaactttgaacacactaattaagataatcggcaactctgtcggagcc
cttggaagcctgactgtggtcctggtcattgtgatctttattttctcagtagttggcatg
cagctttttggccgtagcttcaattcccaaaagagtccaaaactctgtaacccgacaggc
ccgacagtctcatgtttacggcactggcacatgggggatttctggcactccttcctagtg
gtattccgcatcctctgcggggaatggatcgaaaatatgtgggaatgtatgcaagaagcg
aatgcatcatcatcattgtgtgttattgtcttcatattgatcacggtgataggaaaactt
gtggtgctcaacctcttcattgccttactgctcaattcctttagcaatgaggaaagaaat
ggaaacttagaaggagaggccaggaaaactaaagtccagttagcactggatcgattccgc
cgggctttttgttttgtgagacacactcttgagcatttctgtcacaagtggtgcaggaag
caaaacttaccacagcaaaaagaggtggcaggaggctgtgctgcacaaagcaaagacatc
attcccctggtcatggagatgaaaaggggctcagagacccaggaggagcttggtatacta
acctctgtaccaaagaccctgggcgtcaggcatgattggacttggttggcaccacttgcg
gaggaggaagatgacgttgaattttctggtgaagataatgcacagcgcatcacacaacct
gagcctgaacaacaggcctatgagctccatcaggagaacaagaagcccacgagccagaga
gttcaaagtgtggaaattgacatgttctctgaagatgagcctcatctgaccatacaggat
ccccgaaagaagtctgatgttaccagtatactatcagaatgtagcaccattgatcttcag
gatggctttggatggttacctgagatggttcccaaaaagcaaccagagagatgtttgccc
aaaggctttggttgctgctttccatgctgtagcgtggacaagagaaagcctccctgggtc
atttggtggaacctgcggaaaacctgctaccaaatagtgaaacacagctggtttgagagc
tttattatctttgtgattctgctgagcagtggggcactgatatttgaagatgttcacctt
gagaaccaacccaaaatccaagaattactaaattgtactgacattatttttacacatatt
tttatcctggagatggtactaaaatgggtagccttcggatttggaaagtatttcaccagt
gcctggtgctgccttgatttcatcattgtgattgtctctgtgaccaccctcattaactta
atggaattgaagtccttccggactctacgagcactgaggcctcttcgtgcgctgtcccag
tttgaaggaatgaaggtggtggtcaatgctctcataggtgccatacctgccattctgaat
gttttgcttgtctgcctcattttctggctcgtattttgtattctgggagtatacttcttt
tctggaaaatttgggaaatgcattaatggaacagactcagttataaattataccatcatt
acaaataaaagtcaatgtgaaagtggcaatttctcttggatcaaccagaaagtcaacttt
gacaatgtgggaaatgcttacctcgctctgctgcaagtggcaacatttaagggctggatg
gatattatatatgcagctgttgattccacagagaaagaacaacagccagagtttgagagc
aattcactcggttacatttacttcgtagtctttatcatctttggctcattcttcactctg
aatctcttcattggcgttatcattgacaacttcaaccaacagcagaaaaagttaggtggc
caagacatttttatgacagaagaacagaagaaatactataatgcaatgaaaaaattagga
tccaaaaaacctcaaaaacccattccacggcctctgaacaaatgtcaaggtctcgtgttc
gacatagtcacaagccagatctttgacatcatcatcataagtctcattatcctaaacatg
attagcatgatggctgaatcatacaaccaacccaaagccatgaaatccatccttgaccat
ctcaactgggtctttgtggtcatctttacgttagaatgtctcatcaaaatctttgctttg
aggcaatactacttcaccaatggctggaatttatttgactgtgtggtcgtgcttctttcc
attgttagtacaatgatttctaccttggaaaatcaggagcacattcctttccctccgacg
ctcttcagaattgtccgcttggctcggattggccgaatcctgaggcttgtccgggctgca
cgaggaatcaggactctcctctttgctctgatgatgtcgcttccttctctgttcaacatt
ggtcttctactctttctgattatgtttatctatgccattctgggtatgaactggttttcc
aaagtgaatccagagtctggaatcgatgacatattcaacttcaagacttttgccagcagc
atgctctgtctcttccagataagcacatcagcaggttgggattccctgctcagccccatg
ctgcgatcaaaagaatcatgtaactcttcctcagaaaactgccacctccctggcatagcc
acatcctactttgtcagttacattatcatctcctttctcattgttgtcaacatgtacatt
gctgtgattttagagaacttcaatacagccactgaagaaagtgaggaccctttgggtgaa
gatgactttgacatattttatgaagtgtgggaaaagtttgacccagaagcaacacaattt
atcaaatattctgccctttctgactttgctgatgccttgcctgagcctttgcgtgtcgca
aagccaaataaatatcaatttctagtaatggacttgcccatggtgagtgaagatcgcctc
cactgcatggatattcttttcgccttcaccgctagggtactcggtggctctgatggccta
gatagtatgaaagcaatgatggaagagaagttcatggaagccaatcctctcaagaagttg
tatgaacccatagtcaccaccaccaagagaaaggaagaggaaagaggtgctgctattatt
caaaaggcctttcgaaagtacatgatgaaggtgaccaagggtgaccaaggtgaccaaaat
gacttggaaaacgggcctcattcaccactccagactctttgcaatggagacttgtctagc
tttggggtggccaagggcaaggtccactgtgactga

DBGET integrated database retrieval system