KEGG   Homo sapiens (human): 11282Help
Entry
11282             CDS       T01001                                 

Gene name
MGAT4B, GNT-IV, GNT-IVB
Definition
(RefSeq) alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
  KO
K00738  alpha-1,3-mannosylglycoprotein beta-1,4-N-acetylglucosaminyltransferase A/B [EC:2.4.1.145]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    11282 (MGAT4B)
   00513 Various types of N-glycan biosynthesis
    11282 (MGAT4B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    11282 (MGAT4B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.145  alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     11282 (MGAT4B)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   11282 (MGAT4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_54 STAR_dimer
Motif
Other DBs
NCBI-GeneID: 11282
NCBI-ProteinID: NP_055090
OMIM: 604561
HGNC: 7048
Ensembl: ENSG00000161013
Vega: OTTHUMG00000130912
Pharos: Q9UQ53(Tdark)
UniProt: Q9UQ53
Position
5q35.3
AA seq 548 aa AA seqDB search
MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQKGDVVDVYQREFLALRDRLHAAEQESLKR
SKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLP
HLLAKESSLQPAVRVGQGRTGVSVVMGIPSVRREVHSYLTDTLHSLISELSPQEKEDSVI
VVLIAETDSQYTSAVTENIKALFPTEIHSGLLEVISPSPHFYPDFSRLRESFGDPKERVR
WRTKQNLDYCFLMMYAQSKGIYYVQLEDDIVAKPNYLSTMKNFALQQPSEDWMILEFSQL
GFIGKMFKSLDLSLIVEFILMFYRDKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIR
FKPSLFQHVGTHSSLAGKIQKLKDKDFGKQALRKEHVNPPAEVSTSLKTYQHFTLEKAYL
REDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDK
EALQEGRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPVWVILS
EIFLKKAD
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccgcaatggcaccttcctgacgctgctgctcttctgcctgtgcgccttcctc
tcgctgtcctggtacgcggcactcagcggccagaaaggcgacgttgtggacgtttaccag
cgggagttcctggcgctgcgcgatcggttgcacgcagctgagcaggagagcctcaagcgc
tccaaggagctcaacctggtgctggacgagatcaagagggccgtgtcagaaaggcaggcg
ctgcgagacggagacggcaatcgcacctggggccgcctaacagaggacccccgattgaag
ccgtggaacggctcacaccggcacgtgctgcacctgcccaccgtcttccatcacctgcca
cacctgctggccaaggagagcagtctgcagcccgcggtgcgcgtgggccagggccgcacc
ggagtgtcggtggtgatgggcatcccgagcgtgcggcgcgaggtgcactcgtacctgact
gacactctgcactcgctcatctccgagctgagcccgcaggagaaggaggactcggtcatc
gtggtgctgatcgccgagactgactcacagtacacttcggcagtgacagagaacatcaag
gccttgttccccacggagatccattctgggctcctggaggtcatctcaccctccccccac
ttctaccctgacttctcccgcctccgagagtcctttggggaccccaaggagagagtcagg
tggaggaccaaacagaacctcgattactgcttcctcatgatgtacgcgcagtccaaaggc
atctactacgtgcagctggaggatgacatcgtggccaagcccaactacctgagcaccatg
aagaactttgcactgcagcagccttcagaggactggatgatcctggagttctcccagctg
ggcttcattggtaagatgttcaagtcgctggacctgagcctgattgtagagttcattctc
atgttctaccgggacaagcccatcgactggctcctggaccatattctgtgggtgaaagtc
tgcaaccccgagaaggatgcgaagcactgtgaccggcagaaagccaacctgcggatccgc
ttcaaaccgtccctcttccagcacgtgggcactcactcctcgctggctggcaagatccag
aaactgaaggacaaagactttggaaagcaggcgctgcggaaggagcatgtgaacccgcca
gcagaggtgagcacgagcctgaagacataccagcacttcaccctggagaaagcctacctg
cgcgaggacttcttctgggccttcacccctgccgcgggggacttcatccgcttccgcttc
ttccaacctctaagactggagcggttcttcttccgcagtgggaacatcgagcacccggag
gacaagctcttcaacacgtctgtggaggtgctgcccttcgacaaccctcagtcagacaag
gaggccctgcaggagggccgcaccgccaccctccggtaccctcggagccccgacggctac
ctccagatcggctccttctacaagggagtggcagagggagaggtggacccagccttcggc
cctctggaagcactgcgcctctcgatccagacggactcccctgtgtgggtgattctgagc
gagatcttcctgaaaaaggccgactaa

DBGET integrated database retrieval system