KEGG   Homo sapiens (human): 11283
Entry
11283             CDS       T01001                                 

Gene name
CYP4F8, CPF8, CYPIVF8
Definition
(RefSeq) cytochrome P450 family 4 subfamily F member 8
  KO
K17728  cytochrome P450 family 4 subfamily F8 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    11283 (CYP4F8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    11283 (CYP4F8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     11283 (CYP4F8)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   11283 (CYP4F8)
SSDB
Motif
Pfam: p450 PAS_3
Other DBs
NCBI-GeneID: 11283
NCBI-ProteinID: NP_009184
OMIM: 611545
HGNC: 2648
Ensembl: ENSG00000186526
Vega: OTTHUMG00000182386
Pharos: P98187(Tdark)
UniProt: P98187
Position
19p13.12
AA seq 520 aa
MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWF
LGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDK
DIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQR
LAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFF
RYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFID
VLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE
LLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVC
NINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKV
VLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgtcgctgctgagcctgtcttggctgggcctcaggccggtggcagcatccccgtggctg
ctcctgctggtggtcggggcctcctggctcctggcccgcatcctggcctggacctatgcc
ttctatcacaacggccgccgcctccggtgtttcccgcagccccggaaacagaactggttc
ttgggtcacctgggcctggtcactcccacagaggagggcttgagggtcctgacccagctg
gtggccacctacccccagggctttgtgaggtggttgggccccatcactcccatcatcaac
ttgtgccaccctgacatcgtccgatctgtcatcaatacctcagatgccattacagacaag
gacatagtcttctacaagaccctgaagccctggctgggggatgggctcttgttaagtgtt
ggtgacaagtggagacaccaccgtcgcttgctgacgcctgccttccatttcaacatcctg
aagccctatataaagattttcagcaagagtgcaaacatcatgcatgccaagtggcaacgc
ctggccatggagggcagcacctgtctggatgtgtttgagcacatcagccttatgaccctg
gacagtctgcagaaatgcatcttcagctttgacagcaattgtcaggagaagcccagtgaa
tatattactgcgatcatggagctcagtgcccttgtagtgaaacggaataaccagttcttc
cggtacaaggacttcctgtacttcctcactccctgtggacggcgcttccacagggcctgc
agactggtgcacgacttcacagatgccgtcatccaggagcggcgccgcaccctcactagc
cagggtgttgatgacttcctccaagccaaggccaagtccaagactttggactttattgat
gtgctcctgctgagcgaggataaaaatggtaaagagttgtcagatgaggacataagagca
gaagctgacactttcatgtttggaggccatgacaccacggccagtggcctctcctgggtc
ttgtacaacctcgcgaggcacccagaataccaagaacgctgccggcaggaggtgcaagag
cttctgaaggaccgtgagcctaaagagattgaatgggacgacctggcccagttgcccttc
ctgaccatgtgcctgaaggagagcctgcggttgcatcccccaatccctacattcgcccgc
ggctgcacccaggacgtggtgctcccagacagccgagtcatccccaaagggaatgtctgt
aacatcaacatcttcgcaatccatcacaacccctcagtctggccagaccctgaggtctat
gaccccttccgcttcgacccagaaaacgcccagaagaggtcacctatggcttttattcct
ttctcggcggggcccaggaactgcatcgggcagaagttcgcgatggcagagatgaaggtg
gtcctggcgctcacgctgctgcgcttccgcatcctgcccgaccacagggagccacgcagg
acgccggagattgttttgcgtgcggaggacggactttggctgcgagtagaacccctgggc
tga

DBGET integrated database retrieval system