KEGG   Homo sapiens (human): 1129Help
Entry
1129              CDS       T01001                                 

Gene name
CHRM2, HM2
Definition
(RefSeq) cholinergic receptor muscarinic 2
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04725  Cholinergic synapse
hsa04810  Regulation of actin cytoskeleton
Drug target
Acetylcholine (DG01133): D00999
Aclatonium (DG01291): D01955
Aclidinium bromide: D08837
Alvameline maleate: D02876
Anisotropine methylbromide: D00232
Atropine (DG00052): D00113 D02069
Atropine oxide (DG01243): D03011 D07477
Batefenterol (DG01627): D10545 D10546
Benapryzine hydrochloride: D03076
Benzatropine (DG00859): D00778 D07511
Benzetimide (DG01301): D03087 D07513
Benzilone: D03088
Bethanechol (DG00991): D01000
Bevonium: D01532
Biperiden (DG00852): D00779 D02246 D02247
Butropium bromide: D01491
Butylscopolamine: D01451
Carbachol: D00524
Carpronium (DG01289): D01175 D09752
Chlorpromazine (DG00867): D00270 D00789 D03274 D04034 D09819
Choline alfoscerate: D07349
Cimetropium bromide: D07099
Clidinium bromide: D00716
Cyclopentolate (DG01141): D01002 D07759
Darotropium bromide: D09402
Dexetimide (DG00856): D03711 D07804
Dicycloverine (DG00032): D00717 D07820
Diethazine (DG01921): D02603 D07823
Difemerine: D07079
Dihexyverine (DG00033): D03824 D07821
Dimetindene (DG00386): D07853
Diphenidol (DG02880): D01318 D03858 D03859
Diphenylpiperidinomethyldioxolan iodide: D01600
Diponium bromide: D01463
Elantrine: D03970
Elucaine: D03979
Esoxybutynin chloride: D04057
Etomidoline: D01359
Etybenzatropine: D04087
Eucatropine hydrochloride: D04116
Fenpiverinium: D07070
Fentonium: D07951
Fesoterodine (DG00483): D07226 D08923
Flutropium bromide: D02417
Gallamine: D02292
Heteronium bromide: D04434
Homatropine (DG01142): D01004 D02070
Hyoscyamine (DG00053): D00147 D00719 D01648 D04479
Ipratropium bromide: D02212
Mazaticol (DG00857): D03264 D08157
Mebeverine (DG00030): D04868 D08160
Mepenzolate (DG00040): D00720
Methacholine (DG01290): D04970
Methantheline (DG00036): D00721
Methscopolamine bromide: D00715
Methylatropine (DG01242): D01077 D03814
Methylbenactyzium bromide: D01315
Methylscopolamine: D01976
Metixene (DG00853): D01871 D08209
Metoquizine: D05012
Milameline hydrochloride: D05035
Otilonium bromide: D07083
Oxapium iodide: D01815
Oxitropium bromide: D01946
Oxybutynin (DG00478): D00465 D00722
Oxyphencyclimine (DG00029): D01006 D08325
Parapenzolate bromide: D05360
Pentapiperium methylsulfate: D05418
Penthienate: D07081
Phencarbamide: D05452
Phenglutarimide: D07301
Pilocarpine (DG00992): D00525 D02200 D05478 D08376
Pipenzolate: D07084
Piperidolate (DG00034): D01165 D08382
Pipethanate (DG01255): D01521 D08384
Pipethanate ethobromide: D01987
Pirenzepine (DG00026): D01297 D05276 D08389
Piroheptine (DG01272): D01231 D08395
Poldine: D05535
Pridinol (DG00774): D02064 D08418 D08419
Prifinium bromide: D01377
Procyclidine (DG00854): D00782 D08425
Profenamine (DG00855): D01118 D03276 D08426
Propantheline (DG00035): D00481
Propenzolate hydrochloride: D05628
Propiverine (DG00479): D01007 D08441
Rapacuronium bromide: D05703
Revefenacin: D10978
Rocuronium bromide: D00765
Scopolamine (DG00065): D00138 D02071
Sofpironium bromide: D10989
Tazomeline citrate: D06015
Tematropium methylsulfate: D06061
Tiemonium (DG01254): D08595
Tiemonium iodide: D01201
Timepidium bromide (DG00041): D02535
Tofenacin hydrochloride: D06175
Toquizine: D06192
Triampyzine sulfate: D06217
Tridihexethyl (DG00037): D00723
Trihexyphenidyl (DG00851): D00787 D08638
Tropatepine (DG00858): D07303 D08653
Tropicamide: D00397
Trospium: D01103
Umeclidinium (DG01253): D10180
Umeclidinium bromide: D10181
Valethamate: D01538
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1129 (CHRM2)
   04024 cAMP signaling pathway
    1129 (CHRM2)
   04151 PI3K-Akt signaling pathway
    1129 (CHRM2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1129 (CHRM2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1129 (CHRM2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1129 (CHRM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1129 (CHRM2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    1129 (CHRM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 1129
NCBI-ProteinID: NP_000730
OMIM: 118493
HGNC: 1951
Ensembl: ENSG00000181072
Vega: OTTHUMG00000155658
Pharos: P08172(Tclin)
UniProt: P08172 A4D1Q0 Q86SJ1 Q6SL56
Structure
PDB: 

Position
7q33
AA seq 466 aa AA seqDB search
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaataactcaacaaactcctctaacaatagcctggctcttacaagtccttataagaca
tttgaagtggtgtttattgtcctggtggctggatccctcagtttggtgaccattatcggg
aacatcctagtcatggtttccattaaagtcaaccgccacctccagaccgtcaacaattac
tttttattcagcttggcctgtgctgaccttatcataggtgttttctccatgaacttgtac
accctctacactgtgattggttactggcctttgggacctgtggtgtgtgacctttggcta
gccctggactatgtggtcagcaatgcctcagttatgaatctgctcatcatcagctttgac
aggtacttctgtgtcacaaaacctctgacctacccagtcaagcggaccacaaaaatggca
ggtatgatgattgcagctgcctgggtcctctctttcatcctctgggctccagccattctc
ttctggcagttcattgtaggggtgagaactgtggaggatggggagtgctacattcagttt
ttttccaatgctgctgtcacctttggtacggctattgcagccttctatttgccagtgatc
atcatgactgtgctatattggcacatatcccgagccagcaagagcaggataaagaaggac
aagaaggagcctgttgccaaccaagaccccgtttctccaagtctggtacaaggaaggata
gtgaagccaaacaataacaacatgcccagcagtgacgatggcctggagcacaacaaaatc
cagaatggcaaagcccccagggatcctgtgactgaaaactgtgttcagggagaggagaag
gagagctccaatgactccacctcagtcagtgctgttgcctctaatatgagagatgatgaa
ataacccaggatgaaaacacagtttccacttccctgggccattccaaagatgagaactct
aagcaaacatgcatcagaattggcaccaagaccccaaaaagtgactcatgtaccccaact
aataccaccgtggaggtagtggggtcttcaggtcagaatggagatgaaaagcagaatatt
gtagcccgcaagattgtgaagatgactaagcagcctgcaaaaaagaagcctcctccttcc
cgggaaaagaaagtcaccaggacaatcttggctattctgttggctttcatcatcacttgg
gccccatacaatgtcatggtgctcattaacaccttttgtgcaccttgcatccccaacact
gtgtggacaattggttactggctttgttacatcaacagcactatcaaccctgcctgctat
gcactttgcaatgccaccttcaagaagacctttaaacaccttctcatgtgtcattataag
aacataggcgctacaaggtaa

DBGET integrated database retrieval system